Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Infliximab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Infliximab ELISA Kit

Infliximab ELISA Kit

Product name Infliximab ELISA Kit
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX130
Note For research use only.
Sample type Plasma, Serum
Target Infliximab
Immunogen Infliximab

The Structure and

Activity of Infliximab ELISA Kit

A Powerful Tool for Detecting and Quantifying Antibodies Against a

Therapeutic Target

The Infliximab ELISA Kit is a highly sensitive and specific tool used for the detection and quantification of antibodies against Infliximab, a therapeutic target used in the treatment of various autoimmune diseases. This kit is based on the Enzyme-Linked Immunosorbent Assay (ELISA) technique, which allows for the accurate measurement of antibody levels in biological samples.

Structure of Infliximab ELISA Kit

The Infliximab ELISA Kit is composed of several components, including a microplate coated with Infliximab, a set of standards, and a detection reagent. The microplate is made up of 96 wells, each of which is coated with a specific amount of Infliximab. The standards are used to generate a standard curve, which is used to determine the concentration of antibodies in the sample. The detection reagent is an enzyme-linked secondary antibody that binds to the captured antibodies, allowing for their detection and quantification.

The kit also includes all the necessary buffers, wash solutions, and controls to ensure accurate and reproducible results. The use of high-quality components and strict manufacturing processes ensures the reliability and consistency of the kit.

Activity of Infliximab ELISA Kit

The Infliximab ELISA Kit works on the principle of the ELISA technique, which involves the binding of specific antibodies to their corresponding antigen. In this case, the Infliximab-coated microplate is used to capture the anti-Infliximab antibodies present in the sample. After washing away any unbound components, the detection reagent is added, and the plate is incubated. The enzyme-linked secondary antibody binds to the captured antibodies, and any excess is washed away. The addition of a substrate solution results in the production of a colored product, which is measured using a microplate reader. The intensity of the color is directly proportional to the amount of antibody present in the sample, allowing for the accurate quantification of antibody levels.

The Infliximab ELISA Kit has a high sensitivity, with a detection limit of 0.1 ng/mL. This allows for the detection of even low levels of anti-Infliximab antibodies, making it a valuable tool for monitoring patients undergoing Infliximab therapy. The kit also has a wide dynamic range, allowing for the measurement of a broad range of antibody concentrations.

Application of Infliximab ELISA Kit

The Infliximab ELISA Kit has a wide range of applications in clinical and research settings. It is primarily used for the detection and quantification of anti-Infliximab antibodies in patients undergoing Infliximab therapy. These antibodies can develop in response to the treatment and can reduce its effectiveness, leading to treatment failure. By monitoring antibody levels, physicians can adjust the dosage or switch to a different therapy to ensure the best possible outcome for the patient.

Moreover, the Infliximab ELISA Kit can also be used to study the immunogenicity of Infliximab, i.e., the ability of the drug to induce an immune response. This is particularly important in the development and testing of new biologic drugs, as immunogenicity can affect the safety and efficacy of these therapies.

In addition to its use in clinical settings, the Infliximab ELISA Kit is also a valuable tool for research purposes. It allows for the accurate measurement of anti-Infliximab antibodies in various biological samples, such as serum, plasma, and cell culture supernatants. This can aid in the understanding of the immune response to Infliximab and its role in the development and progression of autoimmune diseases.

Conclusion

The Infliximab ELISA Kit is a powerful tool for the detection and quantification of anti-Infliximab antibodies, providing valuable information

Infliximab ELISA Kit

There are no reviews yet.

Be the first to review “Infliximab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products