Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Suptavumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Suptavumab ELISA Kit

Suptavumab ELISA Kit

Product name Suptavumab ELISA Kit
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX285
Note For research use only.
Sample type Plasma, Serum
Target Suptavumab
Immunogen Suptavumab

Introduction

Suptavumab ELISA Kit is a cutting-edge diagnostic tool that allows for the accurate and efficient detection of the antibody Suptavumab. This antibody has been identified as a potential therapeutic target for various diseases, making the Suptavumab ELISA Kit an essential tool in the field of medical research and treatment. In this article, we will delve into the structure, activity, and application of this highly specialized ELISA kit.

Structure of Suptavumab ELISA Kit

The Suptavumab ELISA Kit is composed of several components that work together to detect the presence of the Suptavumab antibody. The kit contains a microplate coated with a specific antigen that is capable of binding to the Suptavumab antibody. This microplate is divided into wells, each of which can hold a small amount of sample. The kit also includes a series of reagents, including a primary and secondary antibody, that are essential for the detection process.

Activity of Suptavumab ELISA Kit

The Suptavumab ELISA Kit works on the principle of an enzyme-linked immunosorbent assay (ELISA). The first step of this process involves binding the sample containing the Suptavumab antibody to the antigen-coated microplate. Any Suptavumab present in the sample will bind to the antigen, forming an antigen-antibody complex. Next, a primary antibody specific to Suptavumab is added to the well, which binds to the antigen-antibody complex. This is followed by the addition of a secondary antibody that is conjugated with an enzyme. This enzyme then reacts with a substrate, producing a color change that is directly proportional to the amount of Suptavumab present in the sample. The intensity of this color change can be measured using a spectrophotometer, providing a quantitative measure of the Suptavumab antibody in the sample.

Application of Suptavumab ELISA Kit

The Suptavumab ELISA Kit has a wide range of applications in the field of medical research and treatment. One of its primary uses is in the detection of the Suptavumab antibody in patient samples. This allows for the diagnosis and monitoring of diseases where Suptavumab is a known biomarker, such as certain types of cancer and autoimmune disorders. Additionally, the Suptavumab ELISA Kit can also be used in pre-clinical and clinical trials to evaluate the effectiveness of Suptavumab as a potential therapeutic target. The kit can also be used in the development of new drugs that target Suptavumab, providing valuable insights into their efficacy and safety.

Conclusion

The Suptavumab ELISA Kit is a highly specialized diagnostic tool that plays a crucial role in the detection and evaluation of the Suptavumab antibody. Its unique structure and activity make it a powerful tool for researchers and clinicians alike, allowing for the accurate and efficient detection of this important biomarker. With its wide range of applications, the Suptavumab ELISA Kit is an essential component in the advancement of medical research and the development of new treatments for diseases that involve Suptavumab as a therapeutic target.

Suptavumab ELISA Kit

There are no reviews yet.

Be the first to review “Suptavumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products