Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Befovacimab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Befovacimab ELISA Kit

Befovacimab ELISA Kit

Product name Befovacimab ELISA Kit
Uniprot ID P10646
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX170
Note For research use only.
Sample type Plasma, Serum
Target Befovacimab
Immunogen Befovacimab

Introduction

Befovacimab, also known as Avastin, is a monoclonal antibody that is used as a therapeutic agent in the treatment of various cancers. It works by inhibiting the growth of new blood vessels, a process known as angiogenesis, which is crucial for the growth and spread of tumors. The Befovacimab ELISA Kit is a highly sensitive and specific tool used for the detection and quantification of this therapeutic antibody in biological samples. In this article, we will discuss the structure, activity, and application of the Befovacimab ELISA Kit.

Structure of Befovacimab

Befovacimab is a recombinant humanized monoclonal antibody, meaning it is produced in a laboratory using recombinant DNA technology and has been modified to be more similar to human antibodies. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL1) and one variable domain (VL). The variable domains are responsible for binding to the target molecule, in this case, vascular endothelial growth factor (VEGF), while the constant domains provide structural stability and effector functions.

Activity of Befovacimab

Befovacimab specifically targets and binds to VEGF, a protein that plays a critical role in promoting the growth of new blood vessels. By binding to VEGF, Befovacimab prevents it from binding to its receptors on the surface of endothelial cells, thereby inhibiting the formation of new blood vessels. This process is crucial for the growth and spread of tumors, making Befovacimab an effective anti- cancer therapy. In addition to its anti-angiogenic activity, Befovacimab also has immunomodulatory effects, which may contribute to its therapeutic efficacy.

Application of Befovacimab ELISA Kit

The Befovacimab ELISA Kit is a valuable tool for the detection and quantification of Befovacimab in various biological samples, including serum, plasma, and cell culture supernatant. It utilizes the principle of enzyme-linked immunosorbent assay (ELISA), which involves the use of specific antibodies to capture and detect the target molecule. The kit contains all the necessary components, including pre-coated plates, standards, and detection antibodies, for the accurate and sensitive measurement of Befovacimab levels.

The Befovacimab ELISA Kit has several applications in both research and clinical settings. In research, it is used to measure Befovacimab levels in pre-clinical studies, to assess the pharmacokinetics of Befovacimab in animal models, and to evaluate the efficacy of Befovacimab in inhibiting angiogenesis. In the clinical setting, the Befovacimab ELISA Kit is used to monitor Befovacimab levels in patients undergoing treatment, to determine the optimal dosage for individual patients, and to assess the response to therapy.

Conclusion

In summary, Befovacimab is a monoclonal antibody that specifically targets and inhibits VEGF, a protein involved in promoting the growth of new blood vessels. The Befovacimab ELISA Kit is a sensitive and specific tool used for the detection and quantification of this therapeutic antibody in various biological samples. Its applications in research and clinical settings make it an essential tool for studying the structure, activity, and therapeutic potential of Befovacimab. With the increasing use of Befovacimab in cancer treatment, the Befovacimab ELISA Kit will continue to play a crucial role in monitoring and optimizing its therapeutic efficacy.

Befovacimab ELISA Kit

There are no reviews yet.

Be the first to review “Befovacimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products