Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Befovacimab Biosimilar – Anti-TFPI mAb – Research Grade

  • PX-TA1582-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG2-lambda

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade

Product name Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Species Homo sapiens
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Befovacimab ,BAY-1093884,TFPI ,anti-TFPI
Reference PX-TA1582
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Species Homo sapiens
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Befovacimab ,BAY-1093884,TFPI ,anti-TFPI
Reference PX-TA1582
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name PX-TA1582-50
Uniprot ID P10646
Species Homo sapiens
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Befovacimab ,BAY-1093884,TFPI ,anti-TFPI
Reference PX-TA1582
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody

Befovacimab Biosimilar – Anti-TFPI mAb – Research Grade Befovacimab Biosimilar – Anti-TFPI mAb – Research Grade Introduction

Befovacimab Biosimilar is a monoclonal antibody (mAb) that targets tissue factor pathway inhibitor (TFPI), a key regulator of blood coagulation. This research grade antibody is a biosimilar of bevacizumab, a FDA-approved anti-VEGF mAb used in the treatment of various cancers. Befovacimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated for its therapeutic potential in various diseases.

Structure

Befovacimab Biosimilar is a recombinant humanized IgG1 mAb that is produced in Chinese hamster ovary (CHO) cells. It has a molecular weight of approximately 149 kDa and consists of two heavy chains and two light chains. The heavy chains contain four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain two constant domains (CL and CL’) and one variable domain (VL). Befovacimab Biosimilar also contains a human IgG1 Fc region, which is responsible for its effector functions.

Activity

Befovacimab Biosimilar specifically binds to TFPI, a protein that inhibits the activity of tissue factor (TF), a key initiator of blood coagulation. By binding to TFPI, Befovacimab Biosimilar blocks its inhibitory activity and allows TF to activate the coagulation cascade, leading to the formation of a blood clot. This mechanism of action makes Befovacimab Biosimilar a potential therapeutic agent for conditions associated with abnormal blood clotting, such as thrombosis and hemophilia.

Application

Befovacimab Biosimilar is currently being evaluated for its therapeutic potential in various diseases, including cancer, thrombosis, and hemophilia. In cancer, Befovacimab Biosimilar is being studied as a potential alternative to bevacizumab, which has shown to be effective in inhibiting tumor growth by targeting VEGF, a protein involved in angiogenesis. By targeting TFPI, Befovacimab Biosimilar may also inhibit tumor growth by preventing the formation of blood vessels that supply nutrients to the tumor.

In thrombosis, Befovacimab Biosimilar may be used as a potential treatment for conditions such as deep vein thrombosis (DVT) and pulmonary embolism (PE), which are caused by the formation of blood clots in the veins. By blocking TFPI, Befovacimab Biosimilar may help prevent the formation of blood clots and reduce the risk of these conditions.

In hemophilia, Befovacimab Biosimilar may be used as a potential therapy to prevent bleeding episodes in patients with hemophilia A, a genetic disorder characterized by a deficiency of clotting factor VIII. By blocking TFPI, Befovacimab Biosimilar may enhance the activity of clotting factor VIII and improve blood clotting in these patients.

Conclusion

Befovacimab Biosimilar is a promising research grade antibody that specifically targets TFPI, a key regulator of blood coagulation. Its potential applications in cancer, thrombosis, and hemophilia make it a valuable therapeutic agent that may provide an alternative to existing treatments. Further studies and clinical trials are needed to fully evaluate the efficacy and safety of Befovacimab Biosimilar in these conditions.

Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade binds to TFPI, N-His, recombinant protein in ELISA Assay

Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade binds to TFPI, N-His, recombinant protein in ELISA Assay

TFPI, N-His, recombinant protein(cat. No.PX-P5950) at 0.5µg/mL (100µL/well) can bind Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade

SDS-PAGE for Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade

Befovacimab Biosimilar - Anti-TFPI mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Befovacimab  Biosimilar - Anti-TFPI  mAb - Research Grade

There are no reviews yet.

Be the first to review “Befovacimab Biosimilar – Anti-TFPI mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products