Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Marstacimab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Marstacimab ELISA Kit

Marstacimab ELISA Kit

Product name Marstacimab ELISA Kit
Uniprot ID P10646
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX172
Note For research use only.
Sample type Plasma, Serum
Target Marstacimab
Immunogen Marstacimab

Introduction to Marstacimab ELISA Kit

Marstacimab, also known as PF-06741086, is a novel monoclonal antibody that has shown promising results in the treatment of various diseases. It is a humanized IgG1 antibody that specifically targets the protein Factor XIa (FXIa). Marstacimab has been developed by Pfizer and is currently in clinical trials for the treatment of multiple diseases, including thrombosis, hemophilia, and sickle cell disease.

Structure of Marstacimab

Marstacimab is a monoclonal antibody that is produced by recombinant DNA technology. It is a humanized IgG1 antibody, meaning that it contains both human and mouse components. The antibody is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy chains consist of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains consist of two constant regions (CL) and one variable region (VL). The variable regions of the antibody are responsible for binding to the target protein, FXIa.

Mechanism of Action

Marstacimab works by specifically binding to FXIa and inhibiting its activity. FXIa is a serine protease that plays a crucial role in the coagulation cascade. It is responsible for activating Factor IX, which then leads to the formation of blood clots. By inhibiting the activity of FXIa, Marstacimab prevents the formation of blood clots and reduces the risk of thrombosis.

Application of Marstacimab ELISA Kit

The Marstacimab ELISA Kit is a diagnostic tool that is used to measure the levels of Marstacimab in patient samples. This kit is essential in the clinical trials of Marstacimab, as it allows researchers to monitor the levels of the antibody in the patients’ blood. The kit utilizes the enzyme-linked immunosorbent assay (ELISA) technique, which involves the use of specific antibodies to detect and quantify Marstacimab.

Therapeutic Target

Marstacimab is a promising therapeutic target for various diseases, including thrombosis, hemophilia, and sickle cell disease. Thrombosis is a condition characterized by the formation of blood clots in the blood vessels, which can lead to serious complications such as heart attack and stroke. By inhibiting the activity of FXIa, Marstacimab can prevent the formation of blood clots and reduce the risk of thrombosis.

Hemophilia is a genetic disorder in which the blood does not clot properly, leading to excessive bleeding. Marstacimab has shown potential in the treatment of hemophilia by inhibiting the activity of FXIa, which is responsible for activating Factor IX. This can help to control bleeding episodes in patients with hemophilia.

Sickle cell disease is a genetic disorder that affects the shape of red blood cells, causing them to become sickle-shaped. These abnormal red blood cells can get stuck in the blood vessels, leading to blockages and reduced blood flow. Marstacimab has shown promising results in the treatment of sickle cell disease by preventing the formation of blood clots and improving blood flow.

Conclusion

In summary, Marstacimab is a novel monoclonal antibody that specifically targets FXIa and has shown potential in the treatment of various diseases. The Marstacimab ELISA Kit is an essential tool in the clinical trials of this antibody, as it allows researchers to monitor its levels in patient samples. With further research and clinical trials, Marstacimab has the potential to become a valuable therapeutic option for patients with thrombosis, hemophilia, and sickle cell disease.

Marstacimab ELISA Kit

There are no reviews yet.

Be the first to review “Marstacimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products