Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Marstacimab Biosimilar – Anti-TFPI mAb – Research Grade

  • PX-TA1529-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

Product name Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Source CAS 1985638-39-8
Species Homo sapiens
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Marstacimab,PF-06741086,TFPI,anti-TFPI
Reference PX-TA1529
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade
Uniprot ID P10646
Source CAS 1985638-39-8
Species Homo sapiens
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Marstacimab,PF-06741086,TFPI,anti-TFPI
Reference PX-TA1529
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1529-50
Uniprot ID P10646
Source CAS 1985638-39-8
Species Homo sapiens
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Marstacimab,PF-06741086,TFPI,anti-TFPI
Reference PX-TA1529
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction to Marstacimab Biosimilar – A Promising Anti-TFPI mAb

Marstacimab Biosimilar, also known as Anti-TFPI mAb, is a monoclonal antibody that targets Tissue Factor Pathway Inhibitor (TFPI) and has shown promising results in various preclinical and clinical studies. This biosimilar is a research grade therapeutic antibody that has the potential to revolutionize the treatment of various diseases. In this article, we will delve deeper into the structure, activity, and potential applications of Marstacimab Biosimilar.

Structure of Marstacimab Biosimilar

Marstacimab Biosimilar is a recombinant, fully human monoclonal antibody that is produced using Chinese hamster ovary (CHO) cells. It has a molecular weight of approximately 150 kDa and consists of two identical heavy chains and two identical light chains. The heavy chain has a constant region (Fc) and a variable region (Fab) while the light chain has a constant region (CL) and a variable region (VL). The Fab region is responsible for binding to TFPI, while the Fc region is involved in effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Marstacimab Biosimilar

Marstacimab Biosimilar exerts its activity by binding to TFPI, a protein that inhibits the tissue factor pathway of blood coagulation. TFPI is a natural anticoagulant that regulates the initiation of blood clotting by inhibiting the activity of Factor Xa and Factor VIIa. This inhibition prevents the formation of thrombin, the key enzyme in the coagulation cascade. By targeting TFPI, Marstacimab Biosimilar promotes the formation of thrombin, leading to enhanced clotting and reduced bleeding.

Title: Potential Applications of Marstacimab Biosimilar

Marstacimab Biosimilar has shown promising results in preclinical studies for the treatment of various diseases, such as hemophilia, thrombotic disorders, and cancer. In hemophilia, the biosimilar has the potential to reduce bleeding episodes and improve the quality of life for patients by promoting clot formation. In thrombotic disorders, Marstacimab Biosimilar can be used to prevent and treat blood clots by inhibiting TFPI. Additionally, this biosimilar has shown potential in cancer treatment by targeting TFPI, which is overexpressed in certain types of cancer and has been linked to tumor growth and metastasis.

Advantages of Marstacimab Biosimilar

Marstacimab Biosimilar offers several advantages over other anti-TFPI agents. As a fully human monoclonal antibody, it has a lower risk of immunogenicity compared to other antibody-based therapies. It also has a longer half-life, allowing for less frequent dosing and potentially improving patient compliance. Furthermore, as a research grade biosimilar, it offers a cost-effective alternative to the originator drug, making it more accessible to patients.

Conclusion

In conclusion, Marstacimab Biosimilar, also known as Anti-TFPI mAb, is a promising therapeutic antibody that targets TFPI and has the potential to treat various diseases, including hemophilia, thrombotic disorders, and cancer. Its unique structure and mode of action make it a valuable addition to the arsenal of treatments for these conditions. With ongoing research and clinical trials, Marstacimab Biosimilar has the potential to significantly improve patient outcomes and revolutionize the treatment of these diseases.

SDS-PAGE for Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

SDS-PAGE for Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

SEC-HPLC of Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

Marstacimab Biosimilar - Anti-TFPI mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Marstacimab Biosimilar - Anti-TFPI mAb - Research Grade

There are no reviews yet.

Be the first to review “Marstacimab Biosimilar – Anti-TFPI mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products