Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lirilumab Biosimilar – Anti-KIRD2 subgroup mAb – Research Grade

Isotype:
IgG1

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb - Research Grade

Product name Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb - Research Grade
Uniprot ID P43626 & P43627 & P43628
Source CAS 1000676-41-4
Species Homo sapiens
Raw Antigen Sequence MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lirilumab,BMS-986015,IPH2102,KIRD2 subgroup,anti-KIRD2 subgroup
Reference PX-TA1297
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human IgG1
Clonality Monoclonal Antibody
Product name Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb - Research Grade
Uniprot ID P43626 & P43627 & P43628
Source CAS 1000676-41-4
Species Homo sapiens
Raw Antigen Sequence MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lirilumab,BMS-986015,IPH2102,KIRD2 subgroup,anti-KIRD2 subgroup
Reference PX-TA1297
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Human IgG1
Clonality Monoclonal Antibody
Product name PX-TA1297-50
Uniprot ID P43626 & P43627 & P43628
Source CAS 1000676-41-4
Species Homo sapiens
Raw Antigen Sequence MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lirilumab,BMS-986015,IPH2102,KIRD2 subgroup,anti-KIRD2 subgroup
Reference PX-TA1297
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1

General information on Anti-KIRD2 subgroup[Homo sapiens] (Lirilumab) Monoclonal Antibody

Lirilumab has been investigated for the treatment of Leukemia, Cancer, Multiple Myeloma, Lymphocytic Leukemia, and Acute Myeloid Leukemia.

SDS-PAGE for Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb

SDS-PAGE for Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb

Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb binds to CD158a / KIR2DL1, C-His, recombinant protein in INdirect ELISA Assay

Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb binds to CD158a / KIR2DL1, C-His, recombinant protein in INdirect ELISA Assay

Immobilized CD158a / KIR2DL1, C-His, recombinant protein (cat. No.PX-P5573) at 0.5µg/mL (100µL/well) can bind to Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb (cat. No.PX-TA1297) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Lirilumab Biosimilar - Anti-KIRD2 subgroup mAb - Research Grade

  • Furkan Yigitbilek, Elif Ozdogan, Nitin Abrol, Walter D. Park, Michael J. Hansen, Surendra Dasari, Mark D. Stegall and Timucin Taner,Liver mesenchymal stem cells are superior inhibitors of NK cell functions through differences in their secretome compared to other mesenchymal stem cells,Front. Immunol., 21 September 2022, Sec. Alloimmunity and Transplantation, https://doi.org/10.3389/fimmu.2022.952262

There are no reviews yet.

Be the first to review “Lirilumab Biosimilar – Anti-KIRD2 subgroup mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products