Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Batoclimab Biosimilar – Anti-FCGRT mAb – Research Grade

  • PX-TA1581-50
  • Validated ELISA FC
Isotype:
IgG1, lambda

Original price was: $133.00.Current price is: $100.00.

50ug 25% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade

Product name Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Species Homo sapiens
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Species Homo sapiens
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name PX-TA1581-50
Uniprot ID P55899
Species Homo sapiens
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Product name Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Species Homo sapiens
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Species Homo sapiens
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Batoclimab ,HL161,FCGRT,anti-FCGRT
Reference PX-TA1581
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody

Introduction

Batoclimab is a biosimilar, or biologically similar, version of the anti-FCGRT monoclonal antibody (mAb). This therapeutic antibody is used to target the FCGRT protein, which plays a crucial role in the immune system. In this scientific web content, we will discuss the structure, activity, and potential applications of Batoclimab Biosimilar in research.

Structure of Batoclimab Biosimilar

Batoclimab Biosimilar is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for the antibody’s specificity and binds to the FCGRT protein. The constant region, on the other hand, determines the antibody’s effector functions, such as antibody-dependent cellular cytotoxicity and complement-dependent cytotoxicity.

Activity of Batoclimab Biosimilar

Batoclimab Biosimilar works by binding to FCGRT, a protein that plays a crucial role in regulating the lifespan of immunoglobulins (antibodies) in the body. FCGRT is found on the surface of cells in the liver, kidney, and other tissues. It binds to antibodies and transports them back into the bloodstream, extending their half-life and increasing their effectiveness in fighting infections.

By binding to FCGRT, Batoclimab Biosimilar blocks the interaction between FCGRT and antibodies, preventing their recycling and leading to their rapid clearance from the body. This results in a decrease in the levels of circulating antibodies, which can be beneficial in certain diseases where the body produces excessive or harmful antibodies.

Applications of Batoclimab Biosimilar

Batoclimab Biosimilar has potential applications in research for a variety of diseases, including autoimmune disorders, infectious diseases, and cancer. By targeting FCGRT, it can modulate the levels of circulating antibodies and potentially improve disease outcomes.

In autoimmune disorders, such as rheumatoid arthritis and lupus, Batoclimab Biosimilar can reduce the levels of autoantibodies that attack the body’s own tissues. In infectious diseases, such as HIV and viral hepatitis, it can decrease the levels of harmful antibodies that contribute to the disease progression. In cancer, Batoclimab Biosimilar can be used to target tumor-specific antibodies and enhance the effectiveness of other cancer treatments.

Conclusion

In summary, Batoclimab Biosimilar is a biosimilar version of the anti-FCGRT monoclonal antibody, with a similar structure and activity. By targeting FCGRT, it can modulate the levels of circulating antibodies and potentially benefit patients with various diseases. As a research grade antibody, Batoclimab Biosimilar provides a valuable tool for studying the role of FCGRT in different diseases and developing new treatment options.

Flow Cytometry results for Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade

Flow Cytometry results for Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade in ELISA Assay

Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade in ELISA Assay

Batoclimab Biosimilar - Anti-FCGRT mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Batoclimab  Biosimilar - Anti-FCGRT mAb - Research Grade

There are no reviews yet.

Be the first to review “Batoclimab Biosimilar – Anti-FCGRT mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products