Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Enavatuzumab Biosimilar – Anti-TNFRSF12A, CD266 mAb – Research Grade

  • PX-TA1253-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $201.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Enavatuzumab Biosimilar - Anti-TNFRSF12A, CD266 mAb - Research Grade

Product name Enavatuzumab Biosimilar - Anti-TNFRSF12A, CD266 mAb - Research Grade
Uniprot ID Q9NP84
Source CAS 1062149-33-0
Species Humanized
Raw Antigen Sequence MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Enavatuzumab,PDL 192,TNFRSF12A, CD266,anti-TNFRSF12A, CD266
Reference PX-TA1253
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Enavatuzumab Biosimilar - Anti-TNFRSF12A, CD266 mAb - Research Grade
Uniprot ID Q9NP84
Source CAS 1062149-33-0
Species Humanized
Raw Antigen Sequence MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Enavatuzumab,PDL 192,TNFRSF12A, CD266,anti-TNFRSF12A, CD266
Reference PX-TA1253
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1253-50
Uniprot ID Q9NP84
Source CAS 1062149-33-0
Species Humanized
Raw Antigen Sequence MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Enavatuzumab,PDL 192,TNFRSF12A, CD266,anti-TNFRSF12A, CD266
Reference PX-TA1253
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-TNFRSF12A/CD266[Homo sapiens] (Enavatuzumab) Monoclonal Antibody

Enavatuzumab is a humanized monoclonal antibody that targets the TWEAK receptor. It has been investigated for the treatment of cancers.

Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade in WB Assay

Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade in WB Assay

Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

SEC-HPLC of Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade

SEC-HPLC of Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Grade

Enavatuzumab Biosimilar - Anti-TNFRSF12A; CD266 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Enavatuzumab Biosimilar - Anti-TNFRSF12A, CD266 mAb - Research Grade

There are no reviews yet.

Be the first to review “Enavatuzumab Biosimilar – Anti-TNFRSF12A, CD266 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products