Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Felvizumab Biosimilar – Anti-RSV mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Felvizumab Biosimilar - Anti-RSV mAb - Research Grade

Product name Felvizumab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 167747-20-8
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Felvizumab,SB 209763,RSV,anti-RSV
Reference PX-TA1061
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Felvizumab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 167747-20-8
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Felvizumab,SB 209763,RSV,anti-RSV
Reference PX-TA1061
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1061-50
Uniprot ID P03420
Source CAS 167747-20-8
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Felvizumab,SB 209763,RSV,anti-RSV
Reference PX-TA1061
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Felvizumab Biosimilar – Anti-RSV mAb – Research Grade: A Promising Antibody for RSV Treatment Felvizumab biosimilar, also known as anti-RSV mAb, is a monoclonal antibody that has shown great potential in the treatment of respiratory syncytial virus (RSV) infection. This biosimilar is a research grade product that is currently in the pre-clinical stage of development. In this article, we will delve into the structure, activity, and potential applications of Felvizumab biosimilar as a therapeutic target for RSV.

Structure of Felvizumab Biosimilar

Felvizumab biosimilar is a monoclonal antibody that is designed to mimic the structure of the original Felvizumab, a humanized monoclonal antibody that targets the fusion protein of RSV. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have two constant domains (CL and CL1) and one variable domain (VL). The variable domains are responsible for binding to the RSV fusion protein, while the constant domains play a role in effector functions.

Activity of Felvizumab Biosimilar

Felvizumab biosimilar works by binding to the fusion protein of RSV, which is essential for viral entry into host cells. By binding to this protein, Felvizumab blocks the fusion process and prevents the virus from infecting cells. In addition, this biosimilar also activates the immune system to clear the virus from the body. The constant domains of Felvizumab biosimilar interact with immune cells, such as natural killer cells and macrophages, to trigger antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These effector functions help in the elimination of infected cells and control the spread of the virus.

Potential Applications of Felvizumab Biosimilar

The primary application of Felvizumab biosimilar is in the treatment of RSV infection. RSV is a common respiratory virus that can cause severe illness, especially in infants, young children, and older adults. Currently, there is no specific treatment for RSV, and management is limited to supportive care. However, with the development of Felvizumab biosimilar, there is hope for a targeted and effective therapy for RSV.

In addition to its use as a therapeutic agent, Felvizumab biosimilar also has potential applications in research and development. It can be used as a tool in studies investigating the role of RSV fusion protein in viral entry and pathogenesis. Furthermore, this biosimilar can serve as a reference material for the development and validation of RSV diagnostic assays.

Conclusion

Felvizumab biosimilar, also known as anti-RSV mAb, is a promising antibody for the treatment of RSV infection. Its structure, activity, and potential applications make it a valuable asset in the fight against this common respiratory virus. With ongoing research and development, Felvizumab biosimilar has the potential to provide a targeted and effective therapy for RSV, improving outcomes for those affected by this virus.

SDS-PAGE for Felvizumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

SDS-PAGE for Felvizumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

Felvizumab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Felvizumab Biosimilar - Anti-RSV mAb - Research Grade

There are no reviews yet.

Be the first to review “Felvizumab Biosimilar – Anti-RSV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products