Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mitazalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

  • PX-TA1515-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mitazalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name Mitazalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 2055640-86-1
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mitazalimab,ADC-1013,JNJ-64457107,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1515
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Mitazalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 2055640-86-1
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mitazalimab,ADC-1013,JNJ-64457107,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1515
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1515-50
Uniprot ID P25942
Source CAS 2055640-86-1
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mitazalimab,ADC-1013,JNJ-64457107,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1515
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Structure of Mitazalimab Biosimilar – Anti-CD40, TNFRSF5 mAb

Mitazalimab Biosimilar, also known as Anti-CD40, TNFRSF5 mAb, is a monoclonal antibody (mAb) that specifically targets the CD40 receptor on the surface of immune cells. This antibody is a biosimilar version of the original Mitazalimab, which has been developed and approved for clinical use in the treatment of various autoimmune diseases and cancers. The structure of Mitazalimab Biosimilar is similar to that of the original Mitazalimab, with a few minor differences due to the manufacturing process.

The primary structure of Mitazalimab Biosimilar consists of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. The heavy chains have a molecular weight of approximately 50 kDa, while the light chains have a molecular weight of approximately 25 kDa. Together, these chains form a Y-shaped structure, with the heavy chains making up the arms of the Y and the light chains making up the stem.

The variable regions of the heavy and light chains are responsible for the specificity of Mitazalimab Biosimilar. These regions contain unique amino acid sequences that bind specifically to the CD40 receptor on immune cells. The constant regions of the heavy and light chains, on the other hand, are responsible for the effector functions of the antibody, such as binding to other immune cells and activating the complement system.

Activity of Mitazalimab Biosimilar

Mitazalimab Biosimilar is a potent immunomodulatory agent that works by binding to the CD40 receptor on immune cells. This receptor is primarily expressed on B cells, dendritic cells, and macrophages, which are all important players in the immune response. When Mitazalimab Biosimilar binds to the CD40 receptor, it triggers a cascade of signaling events that lead to the activation of these immune cells.

One of the key functions of Mitazalimab Biosimilar is to stimulate the production of cytokines, which are small proteins that regulate the immune response. This includes cytokines such as interleukin-12 (IL-12) and tumor necrosis factor alpha (TNF-α), which are involved in the activation of other immune cells and the initiation of an inflammatory response. By increasing the production of these cytokines, Mitazalimab Biosimilar can enhance the immune response against cancer cells and infectious agents.

In addition, Mitazalimab Biosimilar can also induce the maturation of dendritic cells, which are responsible for presenting antigens to other immune cells. This leads to the activation of T cells, which are essential for mounting an effective immune response. Furthermore, Mitazalimab Biosimilar can also promote the production of antibodies by B cells, which can help in the clearance of pathogens and cancer cells.

Application of Mitazalimab Biosimilar

Mitazalimab Biosimilar has a wide range of potential applications in the field of immunotherapy. One of the main applications is in the treatment of autoimmune diseases, such as rheumatoid arthritis, lupus, and multiple sclerosis. By targeting the CD40 receptor, Mitazalimab Biosimilar can suppress the overactive immune response that is responsible for these diseases.

Another important application of Mitazalimab Biosimilar is in the treatment of cancer. By activating the immune system, this antibody can help in the recognition and elimination of cancer cells. It has shown promising results in clinical trials for the treatment of various types of cancer, including melanoma, breast cancer, and lung cancer.

In addition, Mitazalimab Biosimilar can also be used as a research tool to study the role of the CD40 receptor in various diseases and to develop new therapeutic strategies. Its biosimilar nature makes it a cost-effective option for researchers and clinicians alike.

Overall, Mitazalimab Biosimilar is a powerful immunomodulatory agent with potential applications in the treatment of autoimmune diseases and cancer.

Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Mitazalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mitazalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Mitazalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products