Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lenvervimab Biosimilar – Anti-HBV mAb – Research Grade

  • PX-TA1509-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

Product name Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade
Uniprot ID P03142-3
Source CAS 2055006-79-4
Species Humanized
Raw Antigen Sequence MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lenvervimab,GC-1102 ,HBV,anti-HBV
Reference PX-TA1509
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade
Uniprot ID P03142-3
Source CAS 2055006-79-4
Species Humanized
Raw Antigen Sequence MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lenvervimab,GC-1102 ,HBV,anti-HBV
Reference PX-TA1509
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1509-50
Uniprot ID P03142-3
Source CAS 2055006-79-4
Species Humanized
Raw Antigen Sequence MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lenvervimab,GC-1102 ,HBV,anti-HBV
Reference PX-TA1509
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Lenvervimab Biosimilar, also known as Anti-HBV mAb, is a monoclonal antibody that has been developed as a biosimilar to an existing therapeutic antibody. This biosimilar has been designed to target and treat hepatitis B virus (HBV) infection, which affects millions of people worldwide. In this article, we will discuss the structure, activity, and potential applications of Lenvervimab Biosimilar as a research grade antibody.

Structure of Lenvervimab Biosimilar

Lenvervimab Biosimilar is a monoclonal antibody that is produced in a laboratory using recombinant DNA technology. It is a humanized antibody, meaning that it contains both human and non-human components. The antibody is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The variable regions of the antibody, responsible for recognizing and binding to the target, are derived from the original therapeutic antibody. However, the constant regions of the antibody have been modified to make it more similar to the human antibody, reducing the risk of immune reactions.

Activity of Lenvervimab Biosimilar

Lenvervimab Biosimilar works by binding to a specific protein on the surface of HBV, known as the HBsAg (hepatitis B surface antigen). This binding prevents the virus from entering and infecting liver cells, thus inhibiting its replication and spread. The antibody also activates the body’s immune system to attack and eliminate the virus. This dual mechanism of action makes Lenvervimab Biosimilar a potent and effective treatment for HBV infection.

Applications of Lenvervimab Biosimilar

As a research grade antibody, Lenvervimab Biosimilar has several potential applications in the field of HBV research. It can be used to study the structure and function of the HBV virus, as well as its interaction with the human immune system. The antibody can also be used in diagnostic tests to detect the presence of HBV in patient samples. In addition, Lenvervimab Biosimilar can be used in preclinical studies to evaluate its efficacy and safety as a potential therapeutic for HBV infection.

In vitro studies

Lenvervimab Biosimilar can be used in cell culture studies to investigate its ability to neutralize HBV and inhibit its replication. This can help researchers understand the mechanism of action of the antibody and optimize its dosage and administration for maximum efficacy.

In vivo studies

Animal studies can also be conducted using Lenvervimab Biosimilar to assess its effectiveness in treating HBV infection. These studies can provide valuable data on the antibody’s pharmacokinetics, safety, and potential side effects, which are essential for its development as a therapeutic for human use.

Clinical trials

The ultimate goal of developing Lenvervimab Biosimilar is to bring it to the clinic and make it available as a treatment option for patients with HBV infection. Clinical trials are currently underway to evaluate the safety and efficacy of the antibody in human subjects. If successful, Lenvervimab Biosimilar could offer a more affordable and accessible alternative to the existing therapeutic antibody for the treatment of HBV infection.

Conclusion

Lenvervimab Biosimilar, a research grade anti-HBV mAb, is a promising antibody that shows great potential in the treatment of HBV infection. Its unique structure and dual mechanism of action make it a valuable tool for HBV research and a potential alternative to the existing therapeutic antibody. With ongoing clinical trials, we can hope to see Lenvervimab Biosimilar as a safe and effective treatment option for patients with HBV infection in the near future.

Flow Cytometry results for Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

Flow Cytometry results for Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

SDS-PAGE for Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

There are no reviews yet.

Be the first to review “Lenvervimab Biosimilar – Anti-HBV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products