Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iscalimab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Iscalimab ELISA Kit

Iscalimab ELISA Kit

Product name Iscalimab ELISA Kit
Uniprot ID P25942
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX212
Note For research use only.
Sample type Plasma, Serum
Target Iscalimab
Immunogen Iscalimab

The Structure of Iscalimab ELISA Kit

Iscalimab ELISA Kit is a highly specific and sensitive enzyme-linked immunosorbent assay (ELISA) kit designed for the detection of iscalimab, a novel monoclonal antibody. The kit is composed of several components, including a pre-coated microplate, iscalimab-specific antibodies, and detection reagents.

The pre-coated microplate is coated with a high-affinity capture antibody that specifically binds to iscalimab. This ensures the accurate and efficient capture of iscalimab from the sample being tested. The iscalimab-specific antibodies used in the kit are highly specific and do not cross-react with other antibodies, ensuring the reliability of the results.

The detection reagents used in the kit include a secondary antibody conjugated to an enzyme, such as horseradish peroxidase (HRP), and a substrate that produces a colorimetric signal in the presence of the enzyme. This allows for the quantification of iscalimab levels in the sample.

The Activity of Iscalimab ELISA Kit

The Iscalimab ELISA Kit is a powerful tool for the measurement of iscalimab levels in various biological samples. It utilizes the principle of sandwich ELISA, where the capture antibody binds to iscalimab in the sample, and the detection antibody binds to a different epitope on iscalimab. This results in the formation of a sandwich complex, which is then detected by the enzyme-conjugated secondary antibody.

The kit has a wide dynamic range, allowing for the detection of iscalimab in a broad range of concentrations. It also has a high sensitivity, with a limit of detection as low as 0.1 ng/mL. This makes the kit suitable for the detection of low levels of iscalimab, even in complex biological samples.

The Application of Iscalimab ELISA Kit

Iscalimab ELISA Kit has a wide range of applications in both research and clinical settings. It can be used to measure iscalimab levels in various biological samples, including serum, plasma, and cell culture supernatants. This allows for the monitoring of iscalimab levels in patients undergoing treatment with this therapeutic antibody.

One of the main applications of the Iscalimab ELISA Kit is in the development and optimization of therapeutic antibodies. It can be used to measure the levels of iscalimab in cell culture supernatants, providing valuable information about the production and purification process. This allows for the optimization of the production process, ensuring the production of high-quality and consistent batches of iscalimab.

In clinical settings, the Iscalimab ELISA Kit can be used for the diagnosis and monitoring of various diseases. Iscalimab is a promising therapeutic target for autoimmune diseases, such as rheumatoid arthritis and psoriasis. The kit can be used to measure iscalimab levels in patients with these diseases, providing valuable information about the effectiveness of the treatment.

In addition, the Iscalimab ELISA Kit can also be used in pharmacokinetic studies to measure the levels of iscalimab in the blood over time. This allows for the determination of the drug’s half-life and clearance, providing important information for the development of dosing regimens.

In conclusion, Iscalimab ELISA Kit is a highly sensitive and specific tool for the detection of iscalimab in various biological samples. Its wide range of applications makes it a valuable tool for both research and clinical settings, contributing to the development and optimization of therapeutic antibodies and the diagnosis and monitoring of diseases.

Iscalimab ELISA Kit

There are no reviews yet.

Be the first to review “Iscalimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products