Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirzotamab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mirzotamab ELISA Kit

Mirzotamab ELISA Kit

Product name Mirzotamab ELISA Kit
Uniprot ID Q5ZPR3
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX266
Note For research use only.
Sample type Plasma, Serum
Target Mirzotamab
Immunogen Mirzotamab

Mirzotamab ELISA Kit: A Comprehensive Description Mirzotamab ELISA Kit: Structure, Activity, and Application Introduction

Mirzotamab is a novel humanized monoclonal antibody that has shown promising results in the treatment of various cancers. It targets the delta-like protein 3 (DLL3), a transmembrane protein that is overexpressed in many solid tumors. Mirzotamab ELISA Kit is a diagnostic tool that measures the levels of mirzotamab in biological samples, providing valuable information for monitoring treatment response and optimizing dosage.

Structure of Mirzotamab

Mirzotamab is a fully humanized IgG1/kappa monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, linked by disulfide bonds. The antibody is produced through recombinant DNA technology, ensuring high purity and consistency in its structure.

Mechanism of Action

The primary mechanism of action of mirzotamab is through binding to DLL3 on the surface of tumor cells. This binding leads to internalization and subsequent degradation of DLL3, resulting in inhibition of Notch signaling pathway and induction of apoptosis in cancer cells. Additionally, mirzotamab also activates immune effector cells, such as natural killer cells, to further enhance the anti-tumor effect.

Application of Mirzotamab ELISA Kit

The Mirzotamab ELISA Kit is a valuable tool for monitoring the levels of mirzotamab in patient samples. It can be used for both diagnostic and therapeutic purposes.

Diagnosis

The Mirzotamab ELISA Kit can be used for the diagnosis of DLL3-expressing tumors, as it accurately measures the levels of mirzotamab in patient samples. This information can aid in the selection of appropriate treatment options and monitoring of disease progression.

Treatment Response Monitoring

The levels of mirzotamab in patient samples can serve as a biomarker for treatment response. The Mirzotamab ELISA Kit can be used to monitor the levels of mirzotamab over time, providing valuable information on the effectiveness of treatment and potential need for dosage adjustments.

Optimization of Dosage

The Mirzotamab ELISA Kit can also be used to optimize the dosage of mirzotamab for individual patients. By measuring the levels of mirzotamab in patient samples, healthcare professionals can adjust the dosage to achieve optimal therapeutic levels and minimize potential side effects.

Conclusion

The Mirzotamab ELISA Kit is a crucial tool for the accurate measurement of mirzotamab levels in patient samples. It provides valuable information for diagnosis, treatment response monitoring, and dosage optimization, making it an essential component in the management of DLL3-expressing tumors. With its high sensitivity and specificity, the Mirzotamab ELISA Kit is a reliable and efficient method for assessing the therapeutic activity of mirzotamab.

Mirzotamab ELISA Kit

There are no reviews yet.

Be the first to review “Mirzotamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products