Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirzotamab Biosimilar – Anti-CD276, B7-H3 mAb – Research Grade

  • PX-TA1596-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mirzotamab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade

Product name Mirzotamab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade
Uniprot ID Q5ZPR3
Source CAS 2229859-11-2
Species Chimeric,Humanized
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mirzotamab ,ABBV-155,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1596
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Mirzotamab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade
Uniprot ID Q5ZPR3
Source CAS 2229859-11-2
Species Chimeric,Humanized
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mirzotamab ,ABBV-155,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1596
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1596-50
Uniprot ID Q5ZPR3
Source CAS 2229859-11-2
Species Chimeric,Humanized
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mirzotamab ,ABBV-155,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1596
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Title: Mirzotamab Biosimilar – A Promising Antibody for Targeting CD276, B7-H3

Introduction:

Mirzotamab Biosimilar is a novel antibody that specifically targets CD276, also known as B7-H3, a promising therapeutic target in cancer research. This biosimilar is a research grade version of mirzotamab, a humanized monoclonal antibody that has shown promising results in preclinical and clinical studies for the treatment of various types of cancer.

Structure of Mirzotamab Biosimilar:

Mirzotamab Biosimilar is a recombinant humanized monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The antibody has a typical Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab region is responsible for binding to the target antigen, CD276, while the Fc region is involved in effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Mirzotamab Biosimilar:

Mirzotamab Biosimilar specifically targets CD276, a cell surface protein that is overexpressed in various types of cancer, including breast, lung, ovarian, and prostate cancer. CD276 is a member of the B7 family of co-stimulatory molecules, which play a crucial role in regulating immune responses. It is known to promote tumor growth and metastasis by suppressing anti-tumor immune responses and promoting angiogenesis. By binding to CD276, Mirzotamab Biosimilar blocks its interaction with its receptors on immune cells, thereby restoring anti-tumor immune responses and inhibiting tumor growth.

Application of Mirzotamab Biosimilar:

Mirzotamab Biosimilar has shown promising results in preclinical studies for the treatment of various types of cancer. In a study on breast cancer, treatment with mirzotamab significantly inhibited tumor growth and metastasis in mice. In another study on lung cancer, mirzotamab treatment led to a significant reduction in tumor growth and improved survival in mice. These results suggest that mirzotamab may be effective in treating a wide range of cancers that overexpress CD276.

In addition to its potential as a monotherapy, Mirzotamab Biosimilar also has the potential for combination therapy. It has been shown to enhance the anti-tumor activity of other cancer therapies, such as chemotherapy and immune checkpoint inhibitors. This makes it a promising candidate for use in combination with other treatments to improve their efficacy.

Conclusion:

Mirzotamab Biosimilar is a promising antibody that specifically targets CD276, a cell surface protein that is overexpressed in various types of cancer. Its unique structure and mechanism of action make it a promising candidate for the treatment of cancer. With its potential for monotherapy and combination therapy, Mirzotamab Biosimilar has the potential to significantly improve the treatment outcomes for cancer patients. Further clinical studies are needed to fully evaluate the efficacy and safety of this biosimilar, but the current evidence suggests that it may be a valuable addition to the arsenal of cancer treatments.

Mirzotamab Biosimilar - Anti-CD276,B7-H3 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Mirzotamab Biosimilar - Anti-CD276,B7-H3 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Mirzotamab Biosimilar - Anti-CD276,B7-H3 mAb - Research Grade (cat. No.PX-TA1596) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 7.969M.

Flow Cytometry results for Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade

Flow Cytometry results for Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade

Flow-cytometry using APC anti-human CD276 antibody. PC-3 cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD276 monoclonal antibody (Catalog: PX-TA1596, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Mirzotamab  Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Mirzotamab Biosimilar – Anti-CD276, B7-H3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products