Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD276 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q5ZPR3
Molecular weight:
70kDa

$380.00

100ug + 380 loyalty points
Met1–Thr461 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD276 Recombinant Protein

Product name CD276 Recombinant Protein
Uniprot ID Q5ZPR3
Uniprot link http://www.uniprot.org/uniprot/Q5ZPR3
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT
Molecular weight 70kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr461
Aliases /Synonyms B7H3, PSEC0249, UNQ309/PRO352
Reference PX-P4125
Note For research use only.
Molecular Constructor
Met1–Thr461 His

General information on CD276 Recombinant Protein:

CD276, also known as B7-H3, is a member of the B superfamily and has IgV and IgG regions in the extracellular domain. It is a type I transmembrane protein with 20-27% amino acid identity to other members of the B7 family. B7-H3 participates in the activation of T lymphocytes and regulates the formation of mouse bone. It has also been reported that B7-H3 may play an important role in muscle-immune interaction, providing further evidence for the active role of muscle cells in the local immune regulation process. B7-H3 is expressed on T cells, natural lethal cells and antigenic cells, and certain non-immune cells (such as osteoblasts, fibroblasts, fibroblast-like synovial cells, and epithelial cells). The high expression of B7-H3 in the tumor vasculature also indicates poor patient survival, indicating that it may play a role in the migration of tumor cells.

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb binds to CD276 Recombinant Protein in indirect ELISA Assay

Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb binds to CD276 Recombinant Protein in indirect ELISA Assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind to Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb (cat. No.PX-TA1410) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Omburtamab Biosimilar - Anti-CD276; B7-H3; B7RP-2 mAb - Research Grade (cat. No.PX-TA1532) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 13.01M.

Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade (cat. No.PX-TA1596) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 7.969M.

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade (cat. No.PX-TA1847) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 71.68M.

There are no reviews yet.

Be the first to review “CD276 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products