Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vobramitamab Biosimilar – Anti-CD276 mAb – Research Grade

  • PX-TA1890-100
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $290.00.Current price is: $238.00.

100ug 18% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade

Product name Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade
Uniprot ID Q5ZPR3
Species Homo Sapiens
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vobramitamab,,CD276,anti-CD276
Reference PX-TA1890
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade
Uniprot ID Q5ZPR3
Species Homo Sapiens
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vobramitamab,,CD276,anti-CD276
Reference PX-TA1890
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1890-50
Uniprot ID Q5ZPR3
Species Homo Sapiens
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vobramitamab,,CD276,anti-CD276
Reference PX-TA1890
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Vobramitamab Biosimilar, also known as Anti-CD276 mAb, is a monoclonal antibody that targets the protein CD276, which is overexpressed in various types of cancer cells. This biosimilar is a research-grade version of the original Vobramitamab antibody, and is used in laboratory and preclinical studies for the development of potential cancer therapies. In this article, we will explore the structure, activity, and potential applications of Vobramitamab Biosimilar.

Vobramitamab Biosimilar is a recombinant humanized monoclonal antibody, meaning that it is produced through genetic engineering techniques to resemble human antibodies. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the target protein CD276, while the constant regions determine the functional properties of the antibody.

Vobramitamab Biosimilar specifically targets the protein CD276, also known as B7-H3, which is a member of the B7 family of immune checkpoint proteins. CD276 is overexpressed in many types of cancer cells, including breast, lung, and prostate cancer, and has been shown to play a role in tumor growth and immune evasion. By binding to CD276, Vobramitamab Biosimilar can potentially block its activity and inhibit tumor growth.

In addition to its direct anti-tumor activity, Vobramitamab Biosimilar has also been shown to enhance the immune response against cancer cells. This is due to its ability to bind to CD276 on immune cells, such as T cells and natural killer cells, and activate them to attack cancer cells. This dual mechanism of action makes Vobramitamab Biosimilar a promising candidate for cancer immunotherapy.

As a research-grade antibody, Vobramitamab Biosimilar is primarily used in laboratory and preclinical studies to investigate its potential as a therapeutic agent for cancer. It is often used in combination with other anti- cancer drugs or as part of immunotherapy strategies to assess its efficacy and safety.

In addition to its use in research, Vobramitamab Biosimilar has also been granted orphan drug designation by the US Food and Drug Administration (FDA) for the treatment of neuroblastoma, a type of childhood cancer. This designation is given to drugs that show promise in treating rare diseases, and provides incentives for their development and approval.

In summary, Vobramitamab Biosimilar, also known as Anti-CD276 mAb, is a research-grade monoclonal antibody that targets the protein CD276, which is overexpressed in various types of cancer cells. It has a unique dual mechanism of action, both directly inhibiting tumor growth and enhancing the immune response against cancer cells. Its potential as a cancer therapy is currently being investigated in laboratory and preclinical studies, and it has been granted orphan drug designation for the treatment of neuroblastoma. With further research and development, Vobramitamab Biosimilar may prove to be a valuable addition to the arsenal of anti- cancer therapies.

SDS-PAGE for Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade

SDS-PAGE for Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA Assay

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA Assay

CD276 Recombinant Protein(cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Vobramitamab Biosimilar - Anti-CD276 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vobramitamab Biosimilar – Anti-CD276 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products