Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Enoblituzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Enoblituzumab ELISA Kit

Enoblituzumab ELISA Kit

Product name Enoblituzumab ELISA Kit
Uniprot ID Q5ZPR3
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX265
Note For research use only.
Sample type Plasma, Serum
Target Enoblituzumab
Immunogen Enoblituzumab

Introduction to Enoblituzumab ELISA Kit

Enoblituzumab is a monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of various types of cancer. It specifically targets the protein B7-H3, which is overexpressed in many types of cancer cells. The Enoblituzumab ELISA Kit is a specialized tool used for the detection and measurement of Enoblituzumab in biological samples. In this article, we will discuss the structure, activity, and application of the Enoblituzumab ELISA Kit.

Structure of Enoblituzumab

Enoblituzumab is a humanized IgG1 monoclonal antibody, meaning that it has been modified to have a human-like structure to reduce the risk of immune reactions. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa.

Activity of Enoblituzumab

The primary activity of Enoblituzumab is its ability to bind to the B7-H3 protein. B7-H3 is a member of the B7 family of immune checkpoint proteins and is involved in regulating immune responses. In cancer cells, B7-H3 is often overexpressed, leading to suppression of the immune system and promoting tumor growth. By binding to B7-H3, Enoblituzumab blocks its activity and allows the immune system to recognize and attack cancer cells.

Application of Enoblituzumab ELISA Kit

The Enoblituzumab ELISA Kit is a highly sensitive and specific tool used for the detection and measurement of Enoblituzumab in biological samples. It is commonly used in research and clinical settings to monitor the levels of Enoblituzumab in patients receiving treatment with this antibody.

Research Applications

In research, the Enoblituzumab ELISA Kit is used to measure the pharmacokinetics (PK) and pharmacodynamics (PD) of Enoblituzumab. PK refers to the absorption, distribution, metabolism, and excretion of a drug in the body, while PD refers to the effects of the drug on the body. By measuring the levels of Enoblituzumab in blood or other biological samples, researchers can determine how the drug is distributed and eliminated from the body, as well as its effects on the target protein B7-H3.

Clinical Applications

In clinical settings, the Enoblituzumab ELISA Kit is used to monitor the levels of Enoblituzumab in patients receiving treatment with this antibody. This information can help clinicians determine the optimal dosage and frequency of Enoblituzumab administration for each patient, as well as assess the response to treatment.

Advantages of Enoblituzumab ELISA Kit

The Enoblituzumab ELISA Kit offers several advantages over other methods of Enoblituzumab detection. It is highly sensitive, with a detection limit of 0.1 ng/mL, allowing for accurate measurement of low levels of Enoblituzumab. It is also highly specific, with minimal cross-reactivity with other proteins, ensuring accurate measurement of Enoblituzumab levels in biological samples.

Conclusion

In summary, the Enoblituzumab ELISA Kit is a valuable tool for the detection and measurement of Enoblituzumab in biological samples. Its high sensitivity and specificity make it a reliable method for monitoring Enoblituzumab levels in research and clinical settings. This kit plays a crucial role in understanding the PK and PD of Enoblituzumab and its therapeutic effects in cancer treatment. Further research and development of this kit may lead to improved diagnosis and treatment of cancer in the future.

Enoblituzumab ELISA Kit

There are no reviews yet.

Be the first to review “Enoblituzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products