Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Atidortoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $217.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Atidortoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

Product name Staphylococcus aureus Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1939108-95-8
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Staphylococcus aureus,ASN-1,ASN-100 (combination of atidortoxumab and berlimatoxumab),alpha toxin,anti-alpha toxin
Reference PX-TA1485
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Staphylococcus aureus Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1939108-95-8
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Staphylococcus aureus,ASN-1,ASN-100 (combination of atidortoxumab and berlimatoxumab),alpha toxin,anti-alpha toxin
Reference PX-TA1485
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1485-50
Uniprot ID P09616
Source CAS 1939108-95-8
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Staphylococcus aureus,ASN-1,ASN-100 (combination of atidortoxumab and berlimatoxumab),alpha toxin,anti-alpha toxin
Reference PX-TA1485
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Atidortoxumab Biosimilar – A Promising Anti-Alpha Toxin Antibody for Therapeutic Targeting Atidortoxumab Biosimilar, also known as Anti-alpha toxin mAb, is a novel monoclonal antibody that has shown great potential in targeting and neutralizing alpha toxin, a virulence factor produced by various bacterial pathogens. This biosimilar is a research grade version of the original Atidortoxumab, which is currently in clinical trials for the treatment of various infections caused by alpha toxin-producing bacteria. In this article, we will explore the structure, activity, and potential applications of Atidortoxumab Biosimilar as an anti-alpha toxin antibody.

Structure of Atidortoxumab Biosimilar

Atidortoxumab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced in the laboratory using genetic engineering techniques. It is composed of two heavy chains and two light chains, with a total molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) at the tips of the Y and a crystallizable fragment (Fc) at the base.

The Fab regions of Atidortoxumab Biosimilar are responsible for binding to the alpha toxin, while the Fc region is involved in effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). The antibody has a high affinity for alpha toxin, with a dissociation constant (Kd) in the nanomolar range.

Activity of Atidortoxumab Biosimilar

The main activity of Atidortoxumab Biosimilar is its ability to bind to and neutralize alpha toxin. Alpha toxin is a pore-forming cytotoxin produced by various bacteria, including Staphylococcus aureus, Clostridium perfringens, and Escherichia coli. It plays a crucial role in the pathogenesis of infections caused by these bacteria by damaging host cells and promoting tissue destruction.

Atidortoxumab Biosimilar binds to the alpha toxin with high specificity and prevents it from interacting with its target cells, thereby inhibiting its cytotoxic effects. This antibody has been shown to effectively neutralize alpha toxin in both in vitro and in vivo studies, making it a promising therapeutic agent for the treatment of infections caused by alpha toxin-producing bacteria.

Applications of Atidortoxumab Biosimilar

The potential applications of Atidortoxumab Biosimilar are vast, given the widespread prevalence of alpha toxin-producing bacteria and the limited treatment options available for infections caused by these pathogens. This biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various infections, including skin and soft tissue infections, pneumonia, and sepsis.

In addition to its therapeutic potential, Atidortoxumab Biosimilar also has potential applications in diagnostic and research settings. The antibody can be used in diagnostic assays to detect the presence of alpha toxin in patient samples, aiding in the accurate diagnosis of infections caused by alpha toxin-producing bacteria. It can also be used as a research tool to study the role of alpha toxin in disease pathogenesis and to develop new strategies for targeting this virulence factor.

Conclusion

Atidortoxumab Biosimilar, a research grade version of the original Atidortoxumab, is a promising anti-alpha toxin antibody with a high affinity for alpha toxin and the ability to neutralize its cytotoxic effects. This biosimilar has potential applications in the treatment, diagnosis, and research of infections caused by alpha toxin-producing bacteria. Further studies and clinical trials are needed to fully explore the therapeutic potential of Atidortoxumab Biosimilar and its role in combating alpha toxin-mediated diseases.

Atidortoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

There are no reviews yet.

Be the first to review “Atidortoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products