Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tosatoxumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Tosatoxumab ELISA Kit

Tosatoxumab ELISA Kit

Product name Tosatoxumab ELISA Kit
Uniprot ID P09616
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX289
Note For research use only.
Sample type Plasma, Serum
Target Tosatoxumab
Immunogen Tosatoxumab

Introduction

The Tosatoxumab ELISA Kit is a highly sensitive and specific assay designed for the detection and quantification of Tosatoxumab, a therapeutic antibody targeting the CD3 receptor, in various biological samples. This kit is an essential tool for researchers and clinicians studying the structure, activity and application of Tosatoxumab in various disease models.

Structure of Tosatoxumab

Tosatoxumab is a fully human monoclonal antibody that specifically binds to the CD3 receptor on T cells. The CD3 receptor is a complex of five different proteins, including CD3 gamma, delta, epsilon, zeta and eta chains, which are essential for T cell activation and function. Tosatoxumab is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of Tosatoxumab are responsible for its specificity and binding to the CD3 receptor, while the constant regions are involved in effector functions such as complement activation and antibody-dependent cell-mediated cytotoxicity.

Activity of Tosatoxumab

Tosatoxumab exerts its therapeutic activity by binding to the CD3 receptor on T cells, leading to the formation of a stable complex and subsequent activation of T cells. This activation results in the production and release of cytokines, such as interferon-gamma and interleukin-2, which are important for immune responses. Tosatoxumab also induces T cell proliferation and differentiation, leading to the expansion of effector T cells and the elimination of target cells. Additionally, Tosatoxumab can mediate antibody-dependent cell-mediated cytotoxicity, where immune cells, such as natural killer cells, recognize and kill target cells bound by Tosatoxumab.

Application of Tosatoxumab

Tosatoxumab has shown promising results in various preclinical and clinical studies as a potential treatment for various diseases. It is being investigated for its efficacy in autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis, where it can modulate the immune response and reduce inflammation. Tosatoxumab is also being studied as a potential treatment for certain types of cancer, including T cell lymphomas and leukemias, where it can target and kill cancer cells expressing the CD3 receptor. Moreover, Tosatoxumab has shown potential in organ transplantation, where it can prevent T cell-mediated rejection of transplanted organs.

Tosatoxumab ELISA Kit

The Tosatoxumab ELISA Kit is a highly sensitive and specific assay designed to detect and quantify Tosatoxumab in various biological samples, such as serum, plasma, and cell culture supernatants. This kit utilizes a sandwich ELISA method, where Tosatoxumab is captured by a specific antibody coated on a microplate and then detected by another antibody conjugated with an enzyme. The amount of Tosatoxumab present in the sample is proportional to the signal generated by the enzyme, which can be measured using a spectrophotometer. This kit has a detection range of 0.01-10 ng/mL and a sensitivity of 0.01 ng/mL, making it a highly sensitive tool for the accurate quantification of Tosatoxumab.

Conclusion

The Tosatoxumab ELISA Kit is a valuable tool for researchers and clinicians studying the structure, activity, and application of Tosatoxumab in various disease models. This kit provides a highly sensitive and specific method for the detection and quantification of Tosatoxumab, a therapeutic antibody targeting the CD3 receptor on T cells. With its wide range of applications, Tosatoxumab has the potential to revolutionize the treatment of autoimmune disorders, cancer, and organ transplantation, and the Tosatoxumab ELISA Kit is an essential tool for further research in this field.

Tosatoxumab ELISA Kit

There are no reviews yet.

Be the first to review “Tosatoxumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products