Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tosatoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

  • PX-TA1324-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tosatoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

Product name Tosatoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1374419-41-6
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tosatoxumab,KBSA301,alpha toxin,anti-alpha toxin
Reference PX-TA1324
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Tosatoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1374419-41-6
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tosatoxumab,KBSA301,alpha toxin,anti-alpha toxin
Reference PX-TA1324
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1324-50
Uniprot ID P09616
Source CAS 1374419-41-6
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tosatoxumab,KBSA301,alpha toxin,anti-alpha toxin
Reference PX-TA1324
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

General information on Anti-alpha toxin[Staphylococcus aureus] (Tosatoxumab) Monoclonal Antibody

Tosatoxumab is a human monoclonal antibody (IgG1 lambda) that targets the Staphylococcus aureus alpha-toxin or the S. aureus alpha-hemolysin thus protecting human cells.

SDS-PAGE for Tosatoxumab Biosimilar - Anti-alpha toxin mAb

SDS-PAGE for Tosatoxumab Biosimilar - Anti-alpha toxin mAb

Tosatoxumab Biosimilar - Anti-alpha toxin mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tosatoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

There are no reviews yet.

Be the first to review “Tosatoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products