Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Varisacumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Varisacumab ELISA Kit

Varisacumab ELISA Kit

Product name Varisacumab ELISA Kit
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX190
Note For research use only.
Sample type Plasma, Serum
Target Varisacumab
Immunogen Varisacumab

Introduction to Varisacumab ELISA Kit

Varisacumab ELISA Kit is a powerful tool for detecting and measuring the levels of varisacumab, a promising therapeutic antibody, in biological samples. This kit is specifically designed for use in enzyme-linked immunosorbent assay (ELISA) and provides a reliable and sensitive method for quantifying varisacumab in various sample types.

Structure of Varisacumab

Varisacumab is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2). It is a fully humanized antibody, meaning it is derived from human cells and has a high binding affinity and specificity towards its target. Varisacumab is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa.

Activity of Varisacumab

Varisacumab acts by binding to VEGFR2, a key receptor involved in angiogenesis, the process of forming new blood vessels. VEGFR2 is overexpressed in many types of cancer and is responsible for promoting tumor growth and metastasis. By binding to VEGFR2, varisacumab blocks the binding of its natural ligand, vascular endothelial growth factor (VEGF), and inhibits downstream signaling pathways that promote tumor growth and angiogenesis.

Application of Varisacumab ELISA Kit

The Varisacumab ELISA Kit is a valuable tool for researchers and clinicians studying the role of varisacumab in cancer therapy. It can be used to measure the levels of varisacumab in various biological samples, such as serum, plasma, and cell culture supernatant. This allows for the monitoring of varisacumab levels in patients receiving treatment and can aid in the assessment of treatment response and drug efficacy.

Furthermore, the Varisacumab ELISA Kit can also be used in preclinical studies to evaluate the pharmacokinetics and pharmacodynamics of varisacumab. This information is crucial for determining the optimal dosing regimen and predicting potential side effects of varisacumab in clinical trials.

In addition to its use in cancer research, the Varisacumab ELISA Kit can also be applied in other fields, such as cardiovascular diseases. VEGFR2 is also involved in the development of atherosclerosis and other vascular disorders, making varisacumab a potential therapeutic option for these conditions. The Varisacumab ELISA Kit can be used to measure varisacumab levels in patients with these diseases and assess its potential as a therapeutic agent.

Conclusion

In summary, Varisacumab ELISA Kit is a valuable tool for researchers and clinicians studying the role of varisacumab in cancer therapy and other diseases. Its high sensitivity and specificity make it an ideal method for quantifying varisacumab levels in various sample types. By providing a reliable and sensitive measurement of varisacumab, this kit can aid in the development and evaluation of this promising therapeutic antibody.

Varisacumab ELISA Kit

There are no reviews yet.

Be the first to review “Varisacumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products