Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Varisacumab Biosimilar – Anti-VEGFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $228.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade

Product name Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS 1610010-60-0
Species Homo sapiens
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Varisacumab,AT-001,GNR-011,r84,VEGFA,anti-VEGFA
Reference PX-TA1458
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS 1610010-60-0
Species Homo sapiens
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Varisacumab,AT-001,GNR-011,r84,VEGFA,anti-VEGFA
Reference PX-TA1458
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1458-50
Uniprot ID P15692
Source CAS 1610010-60-0
Species Homo sapiens
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Varisacumab,AT-001,GNR-011,r84,VEGFA,anti-VEGFA
Reference PX-TA1458
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Varisacumab Biosimilar, also known as Anti-VEGFA mAb, is a research grade antibody that targets the vascular endothelial growth factor A (VEGFA) protein. This protein plays a crucial role in the development and maintenance of blood vessels, making it an important therapeutic target in various diseases.

Structure of Varisacumab Biosimilar

Varisacumab Biosimilar is a monoclonal antibody, meaning it is produced by a single type of immune cell. It is a recombinant antibody, meaning it is produced in a laboratory using genetic engineering techniques. The antibody is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. These chains form the Y-shaped structure commonly seen in antibodies.

The variable regions of the antibody, located at the tips of the Y, are responsible for binding to the target protein, VEGFA. The constant regions, located at the base of the Y, are responsible for activating the immune response and mediating other functions of the antibody.

Activity of Varisacumab Biosimilar

Varisacumab Biosimilar binds to VEGFA with high specificity and affinity, meaning it is able to recognize and bind to the target protein with a strong binding force. This binding prevents VEGFA from interacting with its receptors on the surface of endothelial cells, inhibiting its activity.

VEGFA is known to promote the growth of blood vessels, a process called angiogenesis. In certain diseases, such as cancer, this process is dysregulated and leads to excessive blood vessel formation. By inhibiting VEGFA, Varisacumab Biosimilar can help to reduce the growth of blood vessels and potentially slow down the progression of these diseases.

Applications of Varisacumab Biosimilar

Varisacumab Biosimilar has potential applications in various diseases where VEGFA is implicated, including cancer, age-related macular degeneration, and diabetic retinopathy. In cancer, VEGFA promotes the growth of blood vessels that supply nutrients and oxygen to tumors, allowing them to grow and spread. By inhibiting VEGFA, Varisacumab Biosimilar may help to slow down the growth and spread of tumors.

In age-related macular degeneration and diabetic retinopathy, VEGFA contributes to the abnormal growth of blood vessels in the eye, leading to vision loss. Varisacumab Biosimilar may be able to prevent or slow down this abnormal blood vessel growth and preserve vision in these diseases.

Varisacumab Biosimilar is also being studied for its potential use in combination with other therapies, such as chemotherapy, to enhance their effectiveness. By inhibiting VEGFA, Varisacumab Biosimilar may help to improve the delivery of these therapies to tumors, leading to better treatment outcomes.

Conclusion

Varisacumab Biosimilar is a promising research grade antibody that targets VEGFA, an important therapeutic target in various diseases. Its high specificity and affinity for VEGFA make it a potential treatment option for cancer, age-related macular degeneration, and diabetic retinopathy. Further research and clinical trials are needed to fully understand the potential of Varisacumab Biosimilar and its role in the treatment of these diseases.

SDS-PAGE for Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade

SDS-PAGE for Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade

Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Varisacumab Biosimilar – Anti-VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products