Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

VEGFA / VEGF165, C-His, recombinant protein

  • PX-P5977
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P15692-4
Molecular weight:
23.28 kDa

$500.00

100ug + 500 loyalty points
Ala27–Arg191 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

VEGFA / VEGF165, C-His, recombinant protein

Product name VEGFA / VEGF165, C-His, recombinant protein
Uniprot ID P15692-4
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 23.28 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala27-Arg191
Protein Accession P15692
Reference PX-P5977
Note For research use only.
Molecular Constructor
Ala27–Arg191 His

General information on VEGFA / VEGF165, C-His, recombinant protein

Structure

VEGF165 is a member of the VEGF (vascular endothelial growth factor) family of proteins, which are composed of four structural domains: an N-terminal signal peptide, a pro-region, a VEGF homology domain and a C-terminal core domain. The VEGF165 protein is a 165-amino acid glycoprotein, which is secreted and binds to the extracellular matrix.

Activity

VEGF165 is a transcription factor that acts as a growth factor for endothelial cells, stimulating their proliferation and migration. It also regulates the formation of new blood vessels, or angiogenesis. Additionally, VEGF165 has been found to modulate the expression of other genes involved in angiogenesis, such as matrix metalloproteinases.

Application

VEGF165 has a wide range of applications, including cancer therapy. It has been used as an antibody-drug target, as well as a therapeutic agent for the treatment of various types of cancer. Additionally, VEGF165 has been used to treat cardiovascular diseases, such as coronary artery disease, and has been investigated as a potential therapeutic agent for diabetic retinopathy.

Bevacizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in indirect ELISA Assay

Bevacizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in indirect ELISA Assay

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind to Bevacizumab Biosimilar - Anti-VEGF mAb (cat. No.PX-TA1006) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Aflibercept Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Aflibercept Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind Aflibercept Biosimilar - Anti-VEGF mAb (cat. No.PX-TA1016) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 0.52M.

Anti-Human VEGFA Monoclonal binds to VEGFA / VEGF165, C-His, recombinant protein in indirect ELISA Assay

Anti-Human VEGFA Monoclonal binds to VEGFA / VEGF165, C-His, recombinant protein in indirect ELISA Assay

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind to Anti-Human VEGFA Monoclonal (cat. No.PTX19300) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Ranibizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Ranibizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind Ranibizumab Biosimilar - Anti-VEGF mAb (cat. No.PX-TA1008) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 22.11M.

VEGFA / VEGF165, C-His, recombinant protein

There are no reviews yet.

Be the first to review “VEGFA / VEGF165, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products