Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tarcocimab Biosimilar – Anti-VEGFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $608.00.Current price is: $440.00.

100ug 28% OFF + 440 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade

Product name Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS: 2408661-40-3
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tarcocimab,OG1953,VEGFA,anti-VEGFA
Reference PX-TA1780
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS: 2408661-40-3
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tarcocimab,OG1953,VEGFA,anti-VEGFA
Reference PX-TA1780
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1780-50
Uniprot ID P15692
Source CAS: 2408661-40-3
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tarcocimab,OG1953,VEGFA,anti-VEGFA
Reference PX-TA1780
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Tarcocimab Biosimilar: A Promising Anti-VEGFA mAb for Therapeutic Targeting

Tarcocimab Biosimilar, also known as anti-VEGFA monoclonal antibody (mAb), is a novel biological drug that has gained significant attention in the field of cancer therapy. This biosimilar is designed to target the vascular endothelial growth factor A (VEGFA), a protein that plays a crucial role in the formation of new blood vessels. By inhibiting the activity of VEGFA, Tarcocimab Biosimilar has the potential to disrupt the growth and spread of tumors, making it a promising therapeutic option for various types of cancer.

Structure of Tarcocimab Biosimilar

Tarcocimab Biosimilar is a fully humanized IgG1 monoclonal antibody, meaning it is derived from human genes and has a structure similar to naturally occurring antibodies in the body. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of 21 days, allowing for a prolonged duration of action.

The binding site of Tarcocimab Biosimilar is located on the Fab region of the antibody, which is responsible for recognizing and binding to its target, VEGFA. This binding site is highly specific, allowing for selective targeting of VEGFA and minimizing off-target effects.

Mechanism of Action

The main mechanism of action of Tarcocimab Biosimilar is through the inhibition of VEGFA. VEGFA is a key factor in the process of angiogenesis, which is the formation of new blood vessels. In cancer, angiogenesis plays a critical role in tumor growth and metastasis by supplying nutrients and oxygen to the tumor cells. By binding to VEGFA, Tarcocimab Biosimilar prevents its interaction with its receptors on endothelial cells, thereby inhibiting the formation of new blood vessels and reducing the blood supply to the tumor.

In addition to its anti-angiogenic effects, Tarcocimab Biosimilar also has immune-modulating properties. It has been shown to enhance the activity of immune cells, such as natural killer cells and T cells, which can further contribute to its anti-tumor effects.

Application of Tarcocimab Biosimilar

Tarcocimab Biosimilar is currently being evaluated in clinical trials for the treatment of various types of cancer, including colorectal, lung, and breast cancer. The biosimilar has shown promising results in preclinical studies, demonstrating its ability to inhibit tumor growth and improve survival rates.

In addition to its potential as a standalone therapy, Tarcocimab Biosimilar also has the potential to be used in combination with other anti- cancer agents. Studies have shown that combining Tarcocimab Biosimilar with chemotherapy or other targeted therapies can enhance its anti-tumor effects and improve treatment outcomes.

Research Grade Tarcocimab Biosimilar

Research grade Tarcocimab Biosimilar is a high-quality version of the biosimilar that is specifically designed for use in scientific research. It is produced using the same manufacturing process as the clinical grade biosimilar, ensuring consistency and reliability in experimental results.

Research grade Tarcocimab Biosimilar is commonly used in preclinical studies to evaluate its efficacy and safety in various cancer models. It is also used in the development of new treatment strategies and combination therapies.

Conclusion

In conclusion, Tarcocimab Biosimilar is a promising anti-VEGFA mAb with a specific structure and mechanism of action. It has the potential to be a valuable therapeutic option for various types of cancer, and its use in combination with other anti- cancer agents may further improve treatment outcomes. As a research grade biosimilar, it is a valuable tool for scientific research

SDS-PAGE for Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade

SDS-PAGE for Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade

Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade , on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Tarcocimab Biosimilar – Anti-VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products