Brand: ProteoGenix

Brolucizumab Biosimilar – Anti-VEGFA mAb – Research Grade

PX-TA1374-100UG
Quality Chart

Clonality:: Monoclonal Antibody
Isotype:: scFv-kappa-heavy

Original price was: $326.00.Current price is: $238.00.

100ug 27% OFF + 238 loyalty points

Size Size

50ug Original price was: $207.00.Current price is: $167.00.
100ug Original price was: $326.00.Current price is: $238.00.
1MG Original price was: $593.00.Current price is: $482.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Brolucizumab Biosimilar - Anti-VEGFA mAb

Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade

Product name	Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID	P15692
Source	CAS 1531589-13-5
Species	Humanized
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference	PX-TA1374
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	scFv-kappa-heavy
Clonality	Monoclonal Antibody

Product name	Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID	P15692
Source	CAS 1531589-13-5
Species	Humanized
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference	PX-TA1374
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	scFv-kappa-heavy
Clonality	Monoclonal Antibody

Product name	PX-TA1374-50
Uniprot ID	P15692
Source	CAS 1531589-13-5
Species	Humanized
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference	PX-TA1374
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	scFv-kappa-heavy
Clonality	Monoclonal Antibody

General information on Anti-VEGFA[Homo sapiens] (Brolucizumab) Monoclonal Antibody

Brolucizumab is a monoclonal antibody used to treat neovascular age related macular degeneration.

SDS-PAGE for Brolucizumab Biosimilar - Anti-VEGFA mAb

Brolucizumab Biosimilar - Anti-VEGFA mAb, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein antibody is superior than 90 %.

There are no reviews yet.

Be the first to review “Brolucizumab Biosimilar – Anti-VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Brolucizumab Biosimilar – Anti-VEGFA mAb – Research Grade

Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade

General information on Anti-VEGFA[Homo sapiens] (Brolucizumab) Monoclonal Antibody

SDS-PAGE for Brolucizumab Biosimilar - Anti-VEGFA mAb

Related products

Human VEGF Recombinant Protein

Vascular endothelial growth factor A(VEGFA)

VEGFA / VEGF165, C-His, recombinant protein

Anti-Brolucizumab Polyclonal Antibody

Brolucizumab ELISA Kit

InVivoMAb Anti-Human VEGFA (Iv0071)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Brolucizumab Biosimilar – Anti-VEGFA mAb – Research Grade

Specifications Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade

Description

General information on Anti-VEGFA[Homo sapiens] (Brolucizumab) Monoclonal Antibody

Documents

QC & Validation

SDS-PAGE for Brolucizumab Biosimilar - Anti-VEGFA mAb

3D Representation

Reviews

Related products

Human VEGF Recombinant Protein

Vascular endothelial growth factor A(VEGFA)

VEGFA / VEGF165, C-His, recombinant protein

Anti-Brolucizumab Polyclonal Antibody

Brolucizumab ELISA Kit

InVivoMAb Anti-Human VEGFA (Iv0071)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade