Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brolucizumab Biosimilar – Anti-VEGFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
scFv-kappa-heavy

Original price was: $207.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade

Product name Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS 1531589-13-5
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference PX-TA1374
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody
Product name Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS 1531589-13-5
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference PX-TA1374
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody
Product name PX-TA1374-50
Uniprot ID P15692
Source CAS 1531589-13-5
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference PX-TA1374
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody

General information on Anti-VEGFA[Homo sapiens] (Brolucizumab) Monoclonal Antibody

Brolucizumab is a monoclonal antibody used to treat neovascular age related macular degeneration.

SDS-PAGE for Brolucizumab Biosimilar - Anti-VEGFA mAb

SDS-PAGE for Brolucizumab Biosimilar - Anti-VEGFA mAb

Brolucizumab Biosimilar - Anti-VEGFA mAb, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein antibody is superior than 90 %.

Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Brolucizumab Biosimilar – Anti-VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products