Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oportuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
scFv-kappa-heavy

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Oportuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

Product name Oportuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 945228-48-8
Species Humanized
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Oportuzumab,VB4-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1171
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody
Product name Oportuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 945228-48-8
Species Humanized
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Oportuzumab,VB4-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1171
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody
Product name PX-TA1171-50
Uniprot ID P16422
Source CAS 945228-48-8
Species Humanized
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Oportuzumab,VB4-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1171
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody

Introduction to Oportuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade Oportuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade is a monoclonal antibody that targets the epithelial cell adhesion molecule (EPCAM), also known as CD326. This antibody is a biosimilar, meaning it is highly similar to an already approved therapeutic antibody, but manufactured by a different company. Oportuzumab Biosimilar is currently being developed as a potential treatment for various types of cancer.

Structure of Oportuzumab Biosimilar

Oportuzumab Biosimilar is a humanized monoclonal antibody, meaning it is partially derived from human cells to reduce the risk of immune reactions. It is composed of two identical heavy chains and two identical light chains, linked together by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of about 21 days in the body.

Mechanism of Action

EPCAM is a transmembrane glycoprotein that is overexpressed in many types of cancer, including breast, colon, and lung cancer. Oportuzumab Biosimilar specifically binds to EPCAM on the surface of cancer cells, blocking its function and triggering an immune response against the cancer cells. This can lead to cell death and inhibit the growth and spread of cancer.

Title: Applications of Oportuzumab Biosimilar

Oportuzumab Biosimilar is currently being studied as a potential treatment for various types of cancer, including breast, colon, and lung cancer. It is being evaluated as both a monotherapy and in combination with other cancer treatments, such as chemotherapy and targeted therapy. The ultimate goal is to improve patient outcomes and survival rates.

Title: Research Grade vs. Therapeutic Grade

Oportuzumab Biosimilar is currently being developed as a research grade antibody, meaning it is not yet approved for use in patients. Research grade antibodies are used for laboratory research and clinical trials to gather data on safety and efficacy. Once the necessary data is collected and analyzed, the antibody may be further developed and approved for therapeutic use.

Advantages of Oportuzumab Biosimilar

One of the main advantages of Oportuzumab Biosimilar is its potential to be a more affordable alternative to the currently approved EPCAM-targeting antibody. As a biosimilar, it is expected to have similar efficacy and safety as the original antibody, but at a lower cost. This can make it more accessible to patients in need of this type of treatment.

Conclusion

In summary, Oportuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade is a promising monoclonal antibody being developed for the treatment of various types of cancer. Its specific targeting of EPCAM and potential cost-effectiveness make it a valuable addition to the current treatment options for cancer. Further research and clinical trials are needed to fully evaluate its safety and efficacy, but it holds great potential for improving patient outcomes.

Oportuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

There are no reviews yet.

Be the first to review “Oportuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products