Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Edrecolomab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Edrecolomab ELISA Kit

Edrecolomab ELISA Kit

Product name Edrecolomab ELISA Kit
Uniprot ID P16422
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX198
Note For research use only.
Sample type Plasma, Serum
Target Edrecolomab
Immunogen Edrecolomab

Introduction to Edrecolomab ELISA Kit

Edrecolomab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection and quantification of Edrecolomab, a monoclonal antibody, in various biological samples. This ELISA kit is designed to provide accurate and reliable results for research and clinical applications in the field of cancer therapy.

Structure of Edrecolomab

Edrecolomab is a chimeric monoclonal antibody that is composed of both human and murine components. It is a recombinant protein that specifically targets the epithelial cell adhesion molecule (EpCAM), which is highly expressed in many types of cancer cells. The antibody is produced by hybridoma technology, where the murine antibody-producing cells are fused with human myeloma cells to generate a stable cell line that secretes the chimeric antibody.

Activity of Edrecolomab

Edrecolomab binds to the extracellular domain of EpCAM, which is overexpressed on the surface of cancer cells. This binding leads to the activation of various signaling pathways, resulting in the inhibition of tumor growth and metastasis. The antibody also triggers antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which further contribute to the destruction of cancer cells.

Application of Edrecolomab ELISA Kit

The Edrecolomab ELISA Kit has various applications in the field of cancer research and therapy. It is primarily used for the detection and quantification of Edrecolomab in biological samples, such as serum, plasma, and cell culture supernatants. This kit is highly sensitive and can detect Edrecolomab at concentrations as low as 0.1 ng/mL.

The main application of Edrecolomab is in the treatment of EpCAM-positive cancers, such as colorectal, breast, and lung cancer. It is used as a therapeutic agent in combination with chemotherapy or radiation therapy to target and destroy cancer cells. The Edrecolomab ELISA Kit can be used to monitor the levels of Edrecolomab in patients undergoing this treatment, allowing for personalized dosing and treatment optimization.

In addition, the Edrecolomab ELISA Kit can also be used in preclinical studies to evaluate the pharmacokinetics and pharmacodynamics of Edrecolomab. This information is crucial in the development of new treatment strategies and determining the efficacy of Edrecolomab in different cancer types.

Advantages of Edrecolomab ELISA Kit

The Edrecolomab ELISA Kit offers several advantages over other detection methods, such as Western blotting and flow cytometry. It is a simple and cost-effective method that provides accurate and reliable results. The kit is also highly specific, as it only detects Edrecolomab and not other antibodies or proteins. This specificity is crucial in clinical settings, where accurate measurement of Edrecolomab levels is essential for treatment monitoring.

Conclusion

In summary, the Edrecolomab ELISA Kit is a valuable tool for the detection and quantification of Edrecolomab in various biological samples. Its high sensitivity, specificity, and ease of use make it an ideal choice for cancer research and therapy applications. With the increasing use of Edrecolomab in cancer treatment, the demand for this ELISA kit is expected to grow, making it an essential tool for researchers and clinicians alike.

Edrecolomab ELISA Kit

There are no reviews yet.

Be the first to review “Edrecolomab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products