Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Edrecolomab Biosimilar – Anti-EPCAM mAb – Research Grade

  • PX-TA1081-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2a, kappa

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade

Product name Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade
Uniprot ID P16422
Source CAS 156586-89-9
Species Mus musculus
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Edrecolomab,17-1A,EPCAM,anti-EPCAM
Reference PX-TA1081
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-kappa
Clonality Monoclonal Antibody
Product name Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade
Uniprot ID P16422
Source CAS 156586-89-9
Species Mus musculus
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Edrecolomab,17-1A,EPCAM,anti-EPCAM
Reference PX-TA1081
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-kappa
Clonality Monoclonal Antibody
Product name PX-TA1081-50
Uniprot ID P16422
Source CAS 156586-89-9
Species Mus musculus
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Edrecolomab,17-1A,EPCAM,anti-EPCAM
Reference PX-TA1081
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody

Title: Understanding the Structure and Function of Edrecolomab Biosimilar – Anti-EPCAM mAb

Introduction

Edrecolomab is a biosimilar monoclonal antibody (mAb) that targets the epithelial cell adhesion molecule (EPCAM). It has been extensively studied for its potential therapeutic applications in various cancers. In this article, we will delve deeper into the structure, activity, and potential applications of Edrecolomab biosimilar.

Structure of Edrecolomab Biosimilar

Edrecolomab biosimilar is a recombinant humanized IgG1 mAb. It is produced using recombinant DNA technology, where the gene encoding the variable regions of the antibody is inserted into a mammalian cell line. This results in the production of a chimeric antibody, with the variable regions derived from a mouse antibody and the constant regions from a human antibody.

The mAb has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains have two constant regions (CL) and one variable region (VL). The variable regions of Edrecolomab are responsible for its binding specificity to EPCAM.

Activity of Edrecolomab Biosimilar

EPCAM is a transmembrane glycoprotein that is overexpressed in many types of cancers, including colorectal, breast, and lung cancer. Edrecolomab specifically binds to EPCAM, which leads to the activation of immune effector cells, such as natural killer cells and macrophages, to attack and kill cancer cells.

In addition to its direct anti-

cancer activity, Edrecolomab also has the potential to sensitize cancer cells to chemotherapy and radiotherapy. This is achieved through its ability to induce the release of cytokines and chemokines, which can enhance the anti-tumor effects of these treatments.

Potential Applications of Edrecolomab Biosimilar

Edrecolomab biosimilar has shown promising results in pre-clinical and clinical studies for the treatment of various cancers. In particular, it has shown efficacy in the treatment of metastatic colorectal cancer, where it has been shown to improve overall survival when used in combination with chemotherapy.

Apart from its potential as a therapeutic agent, Edrecolomab biosimilar also has potential applications in diagnostic imaging. Due to its high specificity for EPCAM, it can be used as a targeting agent for imaging techniques such as positron emission tomography (PET) and single-photon emission computed tomography (SPECT). This can aid in the early detection and monitoring of cancer progression.

Conclusion

Edrecolomab biosimilar is a recombinant humanized mAb that specifically targets EPCAM, a protein overexpressed in many types of cancers. Its unique structure and mechanism of action make it a promising therapeutic agent for the treatment of various cancers. In addition, its potential applications in diagnostic imaging further add to its value in the field of oncology. Further research and clinical trials are needed to fully explore the potential of Edrecolomab biosimilar in cancer treatment.

SDS-PAGE for Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade

SDS-PAGE for Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade

Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Edrecolomab Biosimilar - Anti-EPCAM mAb binds to Human CD326-EPCAM recombinant protein in indirect ELISA Assay

Edrecolomab Biosimilar - Anti-EPCAM mAb binds to Human CD326-EPCAM recombinant protein in indirect ELISA Assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind to Edrecolomab Biosimilar - Anti-EPCAM mAb (cat. No.PX-TA1081) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Edrecolomab Biosimilar - Anti-EPCAM mAb - Research Grade

There are no reviews yet.

Be the first to review “Edrecolomab Biosimilar – Anti-EPCAM mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products