Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD326-EPCAM recombinant protein

  • PX-P6119
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16422
Molecular weight:
30.58 kDa

$380.00

100ug + 380 loyalty points
Met1–Lys265 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD326-EPCAM recombinant protein

Product name Human CD326-EPCAM recombinant protein
Uniprot ID P16422
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Molecular weight 30.58 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys265
Aliases /Synonyms Epithelial glycoprotein 314, hEGP314, Major gastrointestinal tumor-associated protein GA733-2, EGP314, TACSTD1, Adenocarcinoma-associated antigen, TROP1, EPCAM, Epithelial glycoprotein, KS 1/4 antigen, Tumor-associated calcium signal transducer 1, M4S1, CD326, Ep-CAM, EGP, Epithelial cell adhesion molecule, M1S2, KSA, Cell surface glycoprotein Trop-1, GA733-2, Epithelial cell surface antigen, MIC18, Drug Target
Reference PX-P6119
Note For research use only.
Molecular Constructor
Met1–Lys265 His

Edrecolomab Biosimilar - Anti-EPCAM mAb binds to Human CD326-EPCAM recombinant protein in indirect ELISA Assay

Edrecolomab Biosimilar - Anti-EPCAM mAb binds to Human CD326-EPCAM recombinant protein in indirect ELISA Assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind to Edrecolomab Biosimilar - Anti-EPCAM mAb (cat. No.PX-TA1081) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind Adecatumumab Biosimilar - Anti-EPCAM mAb - Research Grade (cat. No.PX-TA1120) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 55.95M.

Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade (cat. No.PX-TA1170) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 242.66M.

Human CD326-EPCAM recombinant protein

There are no reviews yet.

Be the first to review “Human CD326-EPCAM recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products