Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Citatuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade

  • PX-TA1170-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
Fab-G1-kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Citatuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

Product name Citatuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 945228-49-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Citatuzumab,VB6-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1170
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody
Product name Citatuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 945228-49-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Citatuzumab,VB6-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1170
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1170-50
Uniprot ID P16422
Source CAS 945228-49-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Citatuzumab,VB6-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1170
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab-G1-kappa
Clonality Monoclonal Antibody

Introduction

Citatuzumab Biosimilar, also known as Anti-EPCAM or CD326 mAb, is a monoclonal antibody that targets the epithelial cell adhesion molecule (EPCAM). This biosimilar is a research-grade version of the original Citatuzumab antibody, which has shown promising results in the treatment of various cancers. In this article, we will discuss the structure, activity, and potential applications of Citatuzumab Biosimilar as a therapeutic antibody.

Structure

Citatuzumab Biosimilar is a humanized IgG1 monoclonal antibody, meaning that it is derived from both human and mouse sources. It has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The antibody is made up of four distinct domains: the variable region, which binds to the target antigen, the constant region, which mediates effector functions, and the hinge region, which provides flexibility to the antibody structure.

Activity

Citatuzumab Biosimilar specifically targets EPCAM, a protein that is overexpressed in various types of cancer cells. EPCAM plays a crucial role in cell adhesion and signaling, making it an attractive target for cancer therapy. By binding to EPCAM, Citatuzumab Biosimilar blocks its function and triggers a series of events that ultimately lead to the destruction of cancer cells.

In addition to directly targeting

cancer cells, Citatuzumab Biosimilar also has the ability to recruit immune cells to the site of the tumor. This process, known as antibody-dependent cellular cytotoxicity (ADCC), involves the binding of the antibody to EPCAM on cancer cells, which then activates immune cells to attack and destroy the cancer cells.

Application

Citatuzumab Biosimilar has shown promising results in preclinical studies for the treatment of various types of cancer, including colorectal, breast, and lung cancer. It has also been investigated as a potential therapy for other types of solid tumors, such as ovarian and pancreatic cancer.

One potential application of Citatuzumab Biosimilar is in combination therapy with other anti- cancer drugs. Studies have shown that combining Citatuzumab with chemotherapy or other targeted therapies can enhance its efficacy and improve patient outcomes. This is due to the ability of Citatuzumab to sensitize cancer cells to the effects of other treatments.

Another potential application of Citatuzumab Biosimilar is in the field of immunotherapy. As mentioned earlier, the antibody has the ability to trigger ADCC, making it a promising candidate for use in immune-based therapies. It has also shown potential in combination with immune checkpoint inhibitors, which are drugs that help activate the immune system to fight cancer.

Conclusion

In summary, Citatuzumab Biosimilar is a promising research-grade therapeutic antibody that specifically targets EPCAM, a protein that is overexpressed in various types of cancer. Its unique structure and activity make it a potential candidate for combination therapy and immunotherapy in the treatment of cancer. Further clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar, but early studies have shown promising results.

Citatuzumab Biosimilar - Anti-CD326,EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Citatuzumab Biosimilar - Anti-CD326,EPCAM mAb - Research Grade binds to Human CD326-EPCAM recombinant protein in ELISA assay

Immobilized Human CD326-EPCAM recombinant protein (cat. No.PX-P6119) at 0.5µg/mL (100µL/well) can bind Citatuzumab Biosimilar - Anti-CD326,EPCAM mAb - Research Grade (cat. No.PX-TA1170) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 242.66M.

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow-cytometry using PE anti-human CD326 antibody. HT-29 cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human CD326 monoclonal antibody (Catalog: PX-TA1170, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow-cytometry using APC anti-human CD326 antibody. HT-29 cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD326 monoclonal antibody (Catalog: PX-TA1170, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow Cytometry results for Citatuzumab Biosimilar - Anti-CD326;EPCAM mAb - Research Grade

Flow-cytometry using FITC anti-human CD326 antibody. HT-29 cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CD326 monoclonal antibody (Catalog: PX-TA1170, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Citatuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

There are no reviews yet.

Be the first to review “Citatuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products