Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Cadherin-1(CDH1)

  • PX-P4709-10
Host species:
Escherichia coli (E.coli)
Uniprot ID:
P12830
Molecular weight:
23.11 kDa

$392.00

+ 392 loyalty points
His Asp155–Asp367
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Cadherin-1(CDH1)

Cadherin-1(CDH1)

Product name Cadherin-1(CDH1)
Uniprot ID P12830
Uniprot link https://www.uniprot.org/uniprot/P12830
Expression system Prokaryotic expression
Sequence DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPAYTLVVQAADLQGEGLSTTATAVITVTD
Molecular weight 23.11 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp155-Asp367
Protein Accession P12830
Spec:Entrez GeneID 999
Spec:NCBI Gene Aliases UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324
Spec:SwissProtID Q13799
NCBI Reference P12830
Aliases /Synonyms CAM 120/80,Epithelial cadherin,E-cadherin,Uvomorulin,CD_antigen: CD324,CDHE, UVO
Reference PX-P4709
Note For research use only
Molecular Constructor
His Asp155–Asp367
Product name Cadherin-1(CDH1)
Uniprot ID P12830
Uniprot link https://www.uniprot.org/uniprot/P12830
Expression system Prokaryotic expression
Sequence DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPAYTLVVQAADLQGEGLSTTATAVITVTD
Molecular weight 23.11 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp155-Asp367
Protein Accession P12830
Spec:Entrez GeneID 999
Spec:NCBI Gene Aliases UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324
Spec:SwissProtID Q13799
NCBI Reference P12830
Aliases /Synonyms CAM 120/80,Epithelial cadherin,E-cadherin,Uvomorulin,CD_antigen: CD324,CDHE, UVO
Reference PX-P4709
Note For research use only
Molecular Constructor
His Asp155–Asp367

There are no reviews yet.

Be the first to review “Cadherin-1(CDH1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products