Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tuvonralimab Biosimilar – Anti-CTLA4 mAb – Research Grade

  • PX-TA1781-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $370.00.Current price is: $308.00.

50ug 17% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Product name Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2417649-44-4
Species Humanized
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tuvonralimab,PBS-105, PBS105, PSB-205, QL1706,CTLA4,anti-CTLA4
Reference PX-TA1781
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2417649-44-4
Species Humanized
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tuvonralimab,PBS-105, PBS105, PSB-205, QL1706,CTLA4,anti-CTLA4
Reference PX-TA1781
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1781-50
Uniprot ID P16410
Source CAS: 2417649-44-4
Species Humanized
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tuvonralimab,PBS-105, PBS105, PSB-205, QL1706,CTLA4,anti-CTLA4
Reference PX-TA1781
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Tuvonralimab Biosimilar is a research grade antibody that specifically targets the protein CTLA4. This monoclonal antibody (mAb) has shown promising results in pre-clinical studies and is now being developed as a potential therapeutic for various diseases.

Structure of Tuvonralimab Biosimilar

Tuvonralimab Biosimilar is a recombinant, fully humanized IgG1 kappa monoclonal antibody. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to its target, CTLA4, while the constant region determines its effector functions.

The antibody has a molecular weight of approximately 149 kDa and a half-life of approximately 21 days in humans. It is produced using recombinant DNA technology, making it a highly pure and consistent product.

Mechanism of Action

Tuvonralimab Biosimilar works by binding to the protein CTLA4, which is found on the surface of T-cells. CTLA4 is a negative regulator of T-cell activation, meaning it inhibits the activation of T-cells. By binding to CTLA4, Tuvonralimab Biosimilar blocks its inhibitory function and allows the T-cells to become activated.

Activated T-cells play a crucial role in the immune response by identifying and attacking foreign or abnormal cells in the body. By blocking CTLA4, Tuvonralimab Biosimilar enhances the immune response and helps the body fight against diseases.

Applications of Tuvonralimab Biosimilar

Tuvonralimab Biosimilar is currently being investigated as a potential treatment for various diseases, including cancer and autoimmune disorders. By targeting CTLA4, this antibody has the potential to enhance the body’s immune response against cancer cells and reduce the activity of autoreactive T-cells in autoimmune disorders.

Cancer

Tuvonralimab Biosimilar is being studied as a potential treatment for various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. In pre-clinical studies, this antibody has shown promising results in inhibiting tumor growth and improving survival rates. It is believed that Tuvonralimab Biosimilar works by enhancing the body’s immune response against cancer cells, leading to their destruction. This approach, known as immunotherapy, has shown great potential in treating cancer and is being actively researched.

Autoimmune disorders

Autoimmune disorders are characterized by an overactive immune system that attacks healthy cells in the body. Tuvonralimab Biosimilar is being investigated as a potential treatment for autoimmune disorders such as rheumatoid arthritis, multiple sclerosis, and lupus.

By blocking the inhibitory function of CTLA4, Tuvonralimab Biosimilar may help reduce the activity of autoreactive T-cells and alleviate the symptoms of autoimmune disorders.

Conclusion

Tuvonralimab Biosimilar is a research grade antibody that specifically targets the protein CTLA4. Its unique mechanism of action and potential applications in cancer and autoimmune disorders make it a promising therapeutic candidate. Further research and clinical trials are needed to fully understand the potential of this antibody and its role in improving patient outcomes.

Overall, Tuvonralimab Biosimilar has the potential to revolutionize the treatment of various diseases and improve the lives of patients. With its highly specific targeting and minimal side effects, it has the potential to become a valuable addition to the arsenal of immunotherapies currently available.

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade in ELISA Assay

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade in ELISA Assay

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade

SDS-PAGE for Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tuvonralimab Biosimilar – Anti-CTLA4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products