Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CTLA-4 Protein- Cytotoxic T-lymphocyte protein 4 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16410
Molecular weight:
18.51kDa

$250.00

+ 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CTLA-4 Protein- Cytotoxic T-lymphocyte protein 4 recombinant protein

Product name CTLA-4 Protein- Cytotoxic T-lymphocyte protein 4 recombinant protein
Uniprot ID P16410
Uniprot link http://www.uniprot.org/uniprot/P16410
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDGSHHHHHH
Molecular weight 18.51kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CTLA4, Cynw2, CD152, CELIAC3, CTLA4, GSE, IDDM12, Celiac Disease 3, Cytotoxic T-lymphocyte protein 4
Reference PX-P4018
Note For research use only
Molecular Constructor
Partial Yes
Product name CTLA-4 Protein- Cytotoxic T-lymphocyte protein 4 recombinant protein
Uniprot ID P16410
Uniprot link http://www.uniprot.org/uniprot/P16410
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDGSHHHHHH
Molecular weight 18.51kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CTLA4, Cynw2, CD152, CELIAC3, CTLA4, GSE, IDDM12, Celiac Disease 3, Cytotoxic T-lymphocyte protein 4
Reference PX-P4018
Note For research use only
Molecular Constructor
Partial Yes

General Information On CTLA-4 protein

CTLA-4 protein (cytotoxic T-lymphocyte-associated protein 4) also known as Cluster of Differentiation 152 (CD152) is a protein receptor that acts as an immune checkpoint. CD152 protein is expressed in regulatory T cells. CTLA-4 protein is upregulated following T cell activation.
CTLA-4 protein is homologues to CD28 protein although they have opposite functions. CTLA-4 protein transmits inhibitory signals to T cells hence acting as ‘off’ switch whereas CD28 is a T-cell co-stimulatory protein. They both bind to CD80 and CD86 on antigen presenting cells. Furthermore, CD152 bind to CD80 and CD86 with a greater affinity than CD28 and surpasses CD28 activity on the ligands. Research data (Stamper et al. 2001) showed that CTLA-4 and CD80 a periodic arrangement in which bivalent CTLA-4 homodimers bridge bivalent CD80 homodimers. It is believed that this oligomerization provides the structural basis for forming unusually stable signaling complexes at the T-cell surface.
The structure of CTLA-4 protein consist in an extracellular V domain, a transmembrane domain and a cytoplasmic tail. The membrane-bound isoform functions as a homodimer interconnected by a sulfide bond whereas the soluble isoform functions as a monomer. CTLA-4 protein has an intracellular domain which is believed to have no intrinsic catalytic activity. This intracellular domain, similar to that of CD28, contains one YVKM motif that binds PI3K, PP2A, SHP-2 and one proline rich motif that binds to SH3 containing proteins. It is believed that CTLA-4 inhibits T cell activity through SHP-2 and PP2A dephosphorylation of TCR-proximal signaling proteins (CD3 and LAT).

There are no reviews yet.

Be the first to review “CTLA-4 Protein- Cytotoxic T-lymphocyte protein 4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products