Brand: ProteoGenix

Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade

PX-TA1021-50
Validated ELISA

Isotype:: IgG1, kappa

Original price was: $134.00.Current price is: $100.00.

50ug 25% OFF + 100 loyalty points

Size Size

50ug Original price was: $134.00.Current price is: $100.00.
100ug Original price was: $171.00.Current price is: $143.00.
1MG Original price was: $428.00.Current price is: $315.00.
10mg Original price was: $2,160.00.Current price is: $1,577.00.
25mg Original price was: $3,977.00.Current price is: $3,314.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SEC-HPLC of Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Product name	Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa

Product name	Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa

Product name	PX-TA1021-50
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa

Product name	Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1Kappa
Clonality	Monoclonal Antibody

Product name	Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1Kappa
Clonality	Monoclonal Antibody

General information about Ipilimumab

Ipilimumab is a monoclonal antibody used in the treatment of melanoma. It is an antibody that inhibits the CTLA-4 checkpoint of T lymphocytes, a checkpoint that certain cancers activate to decrease the efficiency of the lymphocyte. Ipilimumab is a human monoclonal antibody of the IgG1 type directed against the CTLA-4 protein (Cytotoxic T-Lymphocyte Antigen 4). The inhibition of this receptor present on the T lymphocytes results in the activation of the T lymphocyte. This product is for research use only.

SEC-HPLC of Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

General information about Ipilimumab

SEC-HPLC of Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

SDS-PAGE for Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Related products

CTLA-4 Protein- Cytotoxic T-lymphocyte protein 4 recombinant protein

Cytotoxic T-lymphocyte protein 4(CTLA4)(Ala37-Asp161)

Human CD80, B7-1 recombinant protein

Human CD86, B7-2 recombinant protein

Mouse CTLA-4 recombinant protein

Human IgG1 LALA Isotype Control antibody (HyHEL-10)

Anti-Ipilimumab Polyclonal Antibody

Ipilimumab ELISA Kit

Human CD152/CTLA4 (11.2.1) Monoclonal Antibody

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade

Specifications Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Description

General information about Ipilimumab

Documents

QC & Validation

SEC-HPLC of Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

SDS-PAGE for Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

3D Representation

Reviews

Related products

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade