Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade

  • PX-TA1021-50
  • Validated ELISA
Isotype:
IgG1, kappa

Original price was: $134.00.Current price is: $100.00.

50ug 25% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Product name Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1021-50
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody

General information about Ipilimumab

Ipilimumab is a monoclonal antibody used in the treatment of melanoma. It is an antibody that inhibits the CTLA-4 checkpoint of T lymphocytes, a checkpoint that certain cancers activate to decrease the efficiency of the lymphocyte. Ipilimumab is a human monoclonal antibody of the IgG1 type directed against the CTLA-4 protein (Cytotoxic T-Lymphocyte Antigen 4). The inhibition of this receptor present on the T lymphocytes results in the activation of the T lymphocyte. This product is for research use only.

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade binds to Mouse CTLA-4 recombinant protein in ELISA Assay

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade binds to Mouse CTLA-4 recombinant protein in ELISA Assay

Mouse CTLA-4 recombinant protein(cat. No.PX-P6063) at 0.5µg/mL (100µL/well) can bind Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

SDS-PAGE for Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products