Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD80, B7-1 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P33681
Molecular weight:
28.52kDa

Original price was: $305.00.Current price is: $250.00.

50ug 18% OFF + 250 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD80, B7-1 recombinant protein

Product name Human CD80, B7-1 recombinant protein
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSHHHHHH
Molecular weight 28.52kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD80, CD28LG, CD28LG1, BB1, B7-1 Antigen, T-lymphocyte activation antigen CD80, CTLA-4 counter-receptor B7.1
Reference PX-P4040
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD80, B7-1 recombinant protein
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSHHHHHH
Molecular weight 28.52kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD80, CD28LG, CD28LG1, BB1, B7-1 Antigen, T-lymphocyte activation antigen CD80, CTLA-4 counter-receptor B7.1
Reference PX-P4040
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4040-1MG
Uniprot ID P33681
Uniprot link http://www.uniprot.org/uniprot/P33681
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSHHHHHH
Molecular weight 28.52kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD80, CD28LG, CD28LG1, BB1, B7-1 Antigen, T-lymphocyte activation antigen CD80, CTLA-4 counter-receptor B7.1
Reference PX-P4040
Note For research use only
Molecular Constructor
Partial Yes

General Information about Human CD80/B7-1 recombinant protein

Cluster of Differentiation 80 (CD80/B7-1), recombinant human protein is supplied as a lyophilized powder. It is suitable for analysis of protein structure, investigation of protein-protein interactions, and specific biological research applications. It can also be used as an immunogen or protein standard.

Human CD80, B7-1 recombinant protein

There are no reviews yet.

Be the first to review “Human CD80, B7-1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products