Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD270,TNFRSF14,HVEM recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q92956
Molecular weight:
22.46kDa

Original price was: $565.00.Current price is: $500.00.

100ug 12% OFF + 500 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD270,TNFRSF14,HVEM recombinant protein

Product name Human CD270,TNFRSF14,HVEM recombinant protein
Uniprot ID Q92956
Uniprot link http://www.uniprot.org/uniprot/Q92956
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVGSHHHHHH
Molecular weight 22.46kDa
Protein delivered with Tag? Yes
Purity estimated 40%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 14,Herpes virus entry mediator A,Herpesvirus entry mediator A,HveA,Tumor necrosis factor receptor-like 2,TR2,D270
Reference PX-P4039
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD270,TNFRSF14,HVEM recombinant protein
Uniprot ID Q92956
Uniprot link http://www.uniprot.org/uniprot/Q92956
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVGSHHHHHH
Molecular weight 22.46kDa
Protein delivered with Tag? Yes
Purity estimated 40%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 14,Herpes virus entry mediator A,Herpesvirus entry mediator A,HveA,Tumor necrosis factor receptor-like 2,TR2,D270
Reference PX-P4039
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4039-1MG
Uniprot ID Q92956
Uniprot link http://www.uniprot.org/uniprot/Q92956
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVGSHHHHHH
Molecular weight 22.46kDa
Protein delivered with Tag? Yes
Purity estimated 40%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 14,Herpes virus entry mediator A,Herpesvirus entry mediator A,HveA,Tumor necrosis factor receptor-like 2,TR2,D270
Reference PX-P4039
Note For research use only
Molecular Constructor
Partial Yes

Human CD270,TNFRSF14,HVEM recombinant protein

There are no reviews yet.

Be the first to review “Human CD270,TNFRSF14,HVEM recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products