Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Prezalumab Biosimilar – Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb – Research Grade

  • PX-TA1417-100UG
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $295.00.Current price is: $238.00.

100ug 19% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb - Research Grade

Product name Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb - Research Grade
Uniprot ID O75144
Source CAS 1523164-68-2
Species Homo sapiens
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Prezalumab,AMG 557,MEDI-5872,ICOSLG, B7-H2, B7RP-1, CD275,anti-ICOSLG, B7-H2, B7RP-1, CD275
Reference PX-TA1417
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb - Research Grade
Uniprot ID O75144
Source CAS 1523164-68-2
Species Homo sapiens
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Prezalumab,AMG 557,MEDI-5872,ICOSLG, B7-H2, B7RP-1, CD275,anti-ICOSLG, B7-H2, B7RP-1, CD275
Reference PX-TA1417
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1417-50
Uniprot ID O75144
Source CAS 1523164-68-2
Species Homo sapiens
Raw Antigen Sequence MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Prezalumab,AMG 557,MEDI-5872,ICOSLG, B7-H2, B7RP-1, CD275,anti-ICOSLG, B7-H2, B7RP-1, CD275
Reference PX-TA1417
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

General information on Anti-ICOSLG/B7-H2/B7RP-1/CD275[Homo sapiens] (Prezalumab) Monoclonal Antibody

Prezalumab has been investigated for the treatment of Sjogren’s syndrome Cutaneous Lupus Erythematosus, Psoriasis, and Systemic Lupus Erythematosus (SLE).

SDS-PAGE for Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb

SDS-PAGE for Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb

Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Prezalumab Biosimilar - Anti-CD275;ICOSLG mAb - Research Grade in ELISA Assay

Prezalumab Biosimilar - Anti-CD275;ICOSLG mAb - Research Grade in ELISA Assay

Prezalumab Biosimilar - Anti-CD275;ICOSLG mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Prezalumab Biosimilar - Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb - Research Grade

There are no reviews yet.

Be the first to review “Prezalumab Biosimilar – Anti-ICOSLG, B7-H2, B7RP-1, CD275 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products