Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD270 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q92956
Molecular weight:
36kDa

$249.00

100ug + 249 loyalty points
Met1~Val202 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD270 Recombinant Protein

Product name CD270 Recombinant Protein
Uniprot ID Q92956
Uniprot link http://www.uniprot.org/uniprot/Q92956
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV
Molecular weight 36kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Val202
Protein Accession Q92956
Spec:Entrez GeneID 8764
Spec:NCBI Gene Aliases TR2; ATAR; HVEA; HVEM; CD270; LIGHTR
Spec:SwissProtID Q6IB95
NCBI Reference Q92956
Aliases /Synonyms HVEA, HVEM,TR2
Reference PX-P4113
Note For research use only
Molecular Constructor
Met1~Val202 His

There are no reviews yet.

Be the first to review “CD270 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products