Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD24 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P25063
Molecular weight:
47kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Met1–Gly59 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD24 Recombinant Protein

Product name PX-P4079-100
Uniprot ID P25063
Uniprot link http://www.uniprot.org/uniprot/P25063
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
Molecular weight 47kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly59
Aliases /Synonyms CD24A
Reference PX-P4079
Note For research use only
Molecular Constructor
Met1–Gly59 Fc
Product name PX-P4079-1MG
Uniprot ID P25063
Uniprot link http://www.uniprot.org/uniprot/P25063
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
Molecular weight 47kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly59
Aliases /Synonyms CD24A
Reference PX-P4079
Note For research use only
Molecular Constructor
Met1–Gly59 Fc
Product name PX-P4079-50
Uniprot ID P25063
Uniprot link http://www.uniprot.org/uniprot/P25063
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG
Molecular weight 47kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly59
Aliases /Synonyms CD24A
Reference PX-P4079
Note For research use only
Molecular Constructor
Met1–Gly59 Fc

General information on CD24 Recombinant Protein:

The cluster of differentiation system (CD) is commonly used as a cell marker for immunophenotyping. Different types of cells in the immune system can be identified by surface CD molecules related to cellular immune function. More than 32 unique CD groups and subcategories have been identified. Some CD molecules act as important receptors or ligands for cells, starting a signal cascade and then altering the cell’s behavior. Some CD proteins are not involved in the cell signaling process, but have other functions, such as cell incorporation. Differentiation scissors 24, also known as CD24 signal transducer or stable heatable antigen CD24 (HSA), is a glycoprotein that binds to the glycosylphosphatidylinositol type and binds to the mucin expressed on the surface of B cells, so differentiate into new cells and several tumors. It is involved in the molecular adhesion and spread of the metastatic tumor and acts as a normal receptor for P-selectin. In promoting interaction with platelets and endothelial cells, the CD24 / P selectin pathway may be important in the alienation of tumor cells. It is also considered a tumor marker. High levels of CD24 expression have been found in epithelial ovarian cancer, breast cancer, non-cellular lung cancer, prostate cancer and pancreatic cancer.

CD24 Recombinant Protein

There are no reviews yet.

Be the first to review “CD24 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products