Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD152/CTLA4 (11.2.1) Monoclonal Antibody

Original price was: $546.00.Current price is: $393.00.

100ug 28% OFF + 393 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD152/CTLA4 (11.2.1) Monoclonal Antibody

Product name ARO-A16022-100
Uniprot ID P16410
Uniprot link P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference ARO-A16022
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4 (11.2.1)
Clone Name 11.2.1
Protein Name CD152/CTLA4 (11.2.1)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16022-1MG
Uniprot ID P16410
Uniprot link P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference ARO-A16022
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4 (11.2.1)
Clone Name 11.2.1
Protein Name CD152/CTLA4 (11.2.1)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16022-50
Uniprot ID P16410
Uniprot link P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference ARO-A16022
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD152/CTLA4 (11.2.1)
Clone Name 11.2.1
Protein Name CD152/CTLA4 (11.2.1)
Target species Anti-Human Monoclonal Antibody

Human CD152/CTLA4 (11.2.1) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD152/CTLA4 (11.2.1) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products