Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD152 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P09793
Molecular weight:
17.32 kDa

Original price was: $136.00.Current price is: $115.00.

50ug 15% OFF + 115 loyalty points
Glu36–Phe162 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse CD152 recombinant protein

Mouse CD152 recombinant protein

Product name PX-P6405-100
Uniprot ID P09793
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF
Molecular weight 17.32 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu36-Phe162
Aliases /Synonyms Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, Ctla4, Cd152Cytotoxic T-lymphocyte protein 4,
Reference PX-P6405
Molecular Constructor
Glu36–Phe162 His
Product name PX-P6405-1MG
Uniprot ID P09793
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF
Molecular weight 17.32 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu36-Phe162
Aliases /Synonyms Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, Ctla4, Cd152Cytotoxic T-lymphocyte protein 4,
Reference PX-P6405
Molecular Constructor
Glu36–Phe162 His
Product name PX-P6405-50
Uniprot ID P09793
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF
Molecular weight 17.32 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu36-Phe162
Aliases /Synonyms Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, Ctla4, Cd152Cytotoxic T-lymphocyte protein 4,
Reference PX-P6405
Molecular Constructor
Glu36–Phe162 His

Mouse CD152 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CD152 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products