Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse CD137 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P20334
Molecular weight:
20.91 kDa

Original price was: $445.00.Current price is: $356.00.

100ug 20% OFF + 356 loyalty points
Met1–Leu187 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse CD137 recombinant protein
Mouse CD137 recombinant protein

Mouse CD137 recombinant protein

Product name PX-P6395-100
Uniprot ID P20334
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL
Molecular weight 20.91 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Leu187
Aliases /Synonyms 4-1BB ligand receptor, T-cell antigen 4-1BB, CD137, Tnfrsf9, Cd137, Ila, Ly63Tumor necrosis factor receptor superfamily member 9,
Reference PX-P6395
Molecular Constructor
Met1–Leu187 His
Product name PX-P6395-1MG
Uniprot ID P20334
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL
Molecular weight 20.91 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Leu187
Aliases /Synonyms 4-1BB ligand receptor, T-cell antigen 4-1BB, CD137, Tnfrsf9, Cd137, Ila, Ly63Tumor necrosis factor receptor superfamily member 9,
Reference PX-P6395
Molecular Constructor
Met1–Leu187 His
Product name PX-P6395-50
Uniprot ID P20334
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL
Molecular weight 20.91 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Leu187
Aliases /Synonyms 4-1BB ligand receptor, T-cell antigen 4-1BB, CD137, Tnfrsf9, Cd137, Ila, Ly63Tumor necrosis factor receptor superfamily member 9,
Reference PX-P6395
Molecular Constructor
Met1–Leu187 His

SDS-PAGE for Mouse CD137 recombinant protein

SDS-PAGE for Mouse CD137 recombinant protein

Mouse CD137 recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mouse CD137 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CD137 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products