Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tremelimumab Biosimilar – Anti-CTLA4, CD152 mAb – Research Grade

  • PX-TA1177-50
  • Validated ELISA
Isotype:
IgG2, Kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade

Product name Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS 745013-59-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tremelimumab,Ticilimumab, CP-675,CP-675,206,CP-675206 clone 11.2.1,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1177
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS 745013-59-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tremelimumab,Ticilimumab, CP-675,CP-675,206,CP-675206 clone 11.2.1,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1177
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1177-50
Uniprot ID P16410
Source CAS 745013-59-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tremelimumab,Ticilimumab, CP-675,CP-675,206,CP-675206 clone 11.2.1,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1177
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa

General information on Anti-CTLA4/CD152(Homo sapiens) (Tremelimumab) Monoclonal Antibody

Tremelimumab is studied for the treatment of Mesothelioma, Liver Neoplasms, Liver Cancer, Liver Cell Caricinoma, and HepatoCellular Carcinoma.

SDS-PAGE for Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb

SDS-PAGE for Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb binds to CD152 Recombinant Protein in Indirect ELISA Assay

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb binds to CD152 Recombinant Protein in Indirect ELISA Assay

Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind to Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb (cat. No.PX-TA1177) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Tremelimumab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade in ELISA Assay

Tremelimumab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade in ELISA Assay

Tremelimumab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tremelimumab Biosimilar – Anti-CTLA4, CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products