Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tremelimumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Tremelimumab ELISA Kit

Tremelimumab ELISA Kit

Product name Tremelimumab ELISA Kit
Uniprot ID P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX196
Note For research use only.
Sample type Plasma, Serum
Target Tremelimumab
Immunogen Tremelimumab

Introduction

Tremelimumab is a monoclonal antibody that has gained significant attention in the field of cancer treatment. It is a human IgG2 antibody that specifically targets cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), a protein that plays a critical role in regulating the immune response. Tremelimumab has shown promising results in clinical trials as a potential therapeutic agent for various types of cancer, including melanoma, lung cancer, and mesothelioma. To facilitate the detection and quantification of Tremelimumab in biological samples, a Tremelimumab ELISA Kit has been developed. In this scientific web content, we will provide a detailed description of the structure, activity, and application of Tremelimumab ELISA Kit.

Structure of Tremelimumab ELISA Kit

The Tremelimumab ELISA Kit is a sandwich enzyme-linked immunosorbent assay (ELISA) that utilizes a pair of monoclonal antibodies specific for Tremelimumab. The capture antibody is coated on the surface of a microplate, while the detection antibody is conjugated with an enzyme, typically horseradish peroxidase (HRP). The kit also contains other necessary reagents, such as buffers, standards, and substrates, for the detection and quantification of Tremelimumab.

Activity of Tremelimumab ELISA Kit

The Tremelimumab ELISA Kit works on the principle of the sandwich ELISA method, where the capture antibody binds to Tremelimumab present in the sample, and the detection antibody binds to a different epitope on the Tremelimumab molecule. The HRP enzyme conjugated to the detection antibody catalyzes a colorimetric reaction upon addition of the substrate, resulting in a color change that is directly proportional to the amount of Tremelimumab present in the sample. The intensity of the color is measured using a spectrophotometer, and the concentration of Tremelimumab in the sample is determined by comparing it to a standard curve.

Application of Tremelimumab ELISA Kit

The Tremelimumab ELISA Kit has a wide range of applications in both research and clinical settings. It is primarily used for the detection and quantification of Tremelimumab in serum, plasma, and cell culture supernatants. This allows for the monitoring of Tremelimumab levels in patients undergoing treatment with this monoclonal antibody. The kit can also be used to measure the pharmacokinetics of Tremelimumab, providing valuable information on its absorption, distribution, metabolism, and excretion in the body.

Moreover, the Tremelimumab ELISA Kit can also be used to study the mechanism of action of Tremelimumab. By measuring the levels of Tremelimumab in different biological samples, researchers can gain insights into its binding kinetics, specificity, and stability. This information can aid in the development of more effective therapeutic strategies for using Tremelimumab in cancer treatment.

Conclusion

In conclusion, the Tremelimumab ELISA Kit is a valuable tool for the detection and quantification of Tremelimumab in biological samples. Its structure, activity, and application make it an essential component in the study of this promising monoclonal antibody in cancer treatment. With its high sensitivity, specificity, and ease of use, the Tremelimumab ELISA Kit is a crucial asset for researchers and clinicians in the field of cancer immunotherapy.

Tremelimumab ELISA Kit

There are no reviews yet.

Be the first to review “Tremelimumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products