Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Namilumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Namilumab ELISA Kit

Namilumab ELISA Kit

Product name Namilumab ELISA Kit
Uniprot ID P04141
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX141
Note For research use only.
Sample type Plasma, Serum
Target Namilumab
Immunogen Namilumab

Introduction

Namilumab is a human monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of rheumatoid arthritis (RA). It specifically targets the cytokine granulocyte-macrophage colony-stimulating factor (GM-CSF), which has been implicated in the pathogenesis of RA. Namilumab ELISA Kit is a highly sensitive and specific assay that is used for the detection and quantification of namilumab in biological samples. In this article, we will discuss the structure, activity, and application of the Namilumab ELISA Kit.

Structure of Namilumab

Namilumab is a fully human IgG1 monoclonal antibody that has been engineered to have a high affinity for human GM-CSF. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the heavy and light chains are responsible for binding to GM-CSF, while the constant regions are involved in effector functions such as complement activation and binding to Fc receptors on immune cells.

Activity of Namilumab

Namilumab exerts its therapeutic activity by binding to GM-CSF and preventing it from interacting with its receptor on immune cells. GM-CSF is a pro-inflammatory cytokine that is produced by various cell types, including T cells, macrophages, and fibroblasts. It plays a crucial role in the recruitment and activation of immune cells, which contribute to the chronic inflammation and joint damage seen in RA. By blocking the activity of GM-CSF, namilumab reduces the production of pro-inflammatory cytokines and inhibits the migration and activation of immune cells, thereby suppressing the inflammatory response in RA.

Application of Namilumab ELISA Kit

The Namilumab ELISA Kit is a valuable tool for the development and evaluation of namilumab as a therapeutic agent for RA. It is used to measure the concentration of namilumab in biological samples, such as serum, plasma, or synovial fluid. This information is crucial for determining the pharmacokinetics and pharmacodynamics of namilumab, which can help in optimizing the dosing regimen and predicting its efficacy in patients with RA.

The Namilumab ELISA Kit is also used in clinical trials to assess the safety and efficacy of namilumab. By measuring the levels of namilumab in patients’ samples, researchers can determine if the drug is being adequately absorbed, distributed, and eliminated from the body. This information can also be used to identify any potential drug-drug interactions or adverse effects associated with namilumab.

Moreover, the Namilumab ELISA Kit is a valuable tool for monitoring the response to namilumab therapy in patients with RA. By measuring the levels of namilumab over time, clinicians can assess the drug’s effectiveness in reducing inflammation and joint damage. This information can help in making treatment decisions, such as adjusting the dose or switching to a different therapy if the response is inadequate.

Conclusion

In conclusion, the Namilumab ELISA Kit is a highly sensitive and specific assay that is used for the detection and quantification of namilumab in biological samples. It is an essential tool for the development, evaluation, and monitoring of namilumab as a therapeutic agent for RA. By targeting GM-CSF, namilumab has the potential to provide a new treatment option for patients with RA, and the Namilumab ELISA Kit plays a crucial role in its development and clinical use.

Namilumab ELISA Kit

There are no reviews yet.

Be the first to review “Namilumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products