Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Namilumab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade

  • PX-TA1259-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $203.00.Current price is: $167.00.

50ug 18% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade

Product name Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1206681-39-1
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Namilumab,MT203,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1259
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1206681-39-1
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Namilumab,MT203,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1259
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1259-50
Uniprot ID P04141
Source CAS 1206681-39-1
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Namilumab,MT203,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1259
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-CSF2/GM-CSF[Homo sapiens] (Namilumab) Monoclonal Antibody

Namilumab has beeninvestigated for the treatment of Plaque Psoriasis and Rheumatoid Arthritis.

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb (cat. No.PX-TA1259) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 34.24M.

SDS-PAGE for Namilumab Biosimilar - Anti-CSF2; GM-CSF mAb - Research Grade

SDS-PAGE for Namilumab Biosimilar - Anti-CSF2; GM-CSF mAb - Research Grade

Namilumab Biosimilar - Anti-CSF2; GM-CSF mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade

There are no reviews yet.

Be the first to review “Namilumab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products