Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P15509
Molecular weight:
60 kDa(36.91 kDa)

$250.00

50ug + 250 loyalty points
Met1–Gly320 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)

Product name Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)
Uniprot ID P15509
Uniprot link https://www.uniprot.org/uniprot/P15509
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Molecular weight 60 kDa(36.91 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly320
Protein Accession P15509
Spec:Entrez GeneID 1438
Spec:NCBI Gene Aliases GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha
Spec:SwissProtID Q16564
NCBI Reference P15509
Aliases /Synonyms CSF2R, CSF2RY,GM-CSF-R-alpha,GMCSFR-alpha,GMR-alpha,CDw116,CD116
Reference PX-P4584
Note For research use only
Molecular Constructor
Met1–Gly320 His
Product name Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)
Uniprot ID P15509
Uniprot link https://www.uniprot.org/uniprot/P15509
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Molecular weight 60 kDa(36.91 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly320
Protein Accession P15509
Spec:Entrez GeneID 1438
Spec:NCBI Gene Aliases GMR; CD116; CSF2R; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; alphaGMR; GMR-alpha; GMCSFR-alpha; GM-CSF-R-alpha
Spec:SwissProtID Q16564
NCBI Reference P15509
Aliases /Synonyms CSF2R, CSF2RY,GM-CSF-R-alpha,GMCSFR-alpha,GMR-alpha,CDw116,CD116
Reference PX-P4584
Note For research use only
Molecular Constructor
Met1–Gly320 His

There are no reviews yet.

Be the first to review “Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products