Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mavrilimumab Biosimilar – Anti-CSF2RA, CD116 mAb – Research Grade

  • PX-TA1241-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, lambda2

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mavrilimumab Biosimilar - Anti-CSF2RA, CD116 mAb - Research Grade

Product name Mavrilimumab Biosimilar - Anti-CSF2RA, CD116 mAb - Research Grade
Uniprot ID P15509
Source CAS 1085337-57-0
Species Homo sapiens
Raw Antigen Sequence MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mavrilimumab,CAM-3001,CSF2RA, CD116 ,anti-CSF2RA, CD116
Reference PX-TA1241
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-lambda2
Clonality Monoclonal Antibody
Product name Mavrilimumab Biosimilar - Anti-CSF2RA, CD116 mAb - Research Grade
Uniprot ID P15509
Source CAS 1085337-57-0
Species Homo sapiens
Raw Antigen Sequence MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mavrilimumab,CAM-3001,CSF2RA, CD116 ,anti-CSF2RA, CD116
Reference PX-TA1241
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-lambda2
Clonality Monoclonal Antibody
Product name PX-TA1241-50
Uniprot ID P15509
Source CAS 1085337-57-0
Species Homo sapiens
Raw Antigen Sequence MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mavrilimumab,CAM-3001,CSF2RA, CD116 ,anti-CSF2RA, CD116
Reference PX-TA1241
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, lambda2
Clonality Monoclonal Antibody

Introduction

Mavrilimumab Biosimilar – Anti-CSF2RA, CD116 mAb – Research Grade is a monoclonal antibody (mAb) that targets the cytokine receptor CSF2RA, also known as CD116. This biosimilar is a potential therapeutic option for various inflammatory and autoimmune diseases. In this article, we will discuss the structure, activity, and applications of Mavrilimumab Biosimilar in detail.

Structure of Mavrilimumab Biosimilar

Mavrilimumab Biosimilar is a fully humanized IgG1 monoclonal antibody. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions of the heavy and light chains are responsible for binding to the target protein, CSF2RA. The constant regions of the antibody determine its effector functions, such as complement activation and antibody-dependent cellular cytotoxicity (ADCC).

Activity of Mavrilimumab Biosimilar

Mavrilimumab Biosimilar specifically binds to the extracellular domain of CSF2RA, which is a subunit of the granulocyte-macrophage colony-stimulating factor (GM-CSF) receptor. This receptor is expressed on various immune cells, including neutrophils, macrophages, and dendritic cells. Upon binding, Mavrilimumab Biosimilar blocks the interaction between CSF2RA and its ligand, GM-CSF. This leads to the inhibition of downstream signaling pathways, including the JAK-STAT pathway, and ultimately results in the suppression of inflammatory responses.

Applications of Mavrilimumab Biosimilar

Mavrilimumab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various inflammatory and autoimmune diseases. Some of the potential applications of this biosimilar are discussed below.

1. Rheumatoid Arthritis (RA) RA is a chronic autoimmune disease characterized by inflammation of the joints. It is caused by the overproduction of pro-inflammatory cytokines, including GM-CSF. Mavrilimumab Biosimilar has shown significant efficacy in reducing the signs and symptoms of RA in clinical trials. It also has a good safety profile, making it a potential treatment option for RA patients.

2. Giant Cell Arteritis (GCA) GCA is a systemic vasculitis that primarily affects the medium and large arteries. It is characterized by the infiltration of immune cells in the arterial wall, leading to inflammation and tissue damage. Mavrilimumab Biosimilar has shown promising results in reducing the symptoms of GCA, such as headache and fatigue. It also has the potential to prevent relapses and reduce the need for high-dose corticosteroids, which are commonly used in GCA treatment.

3. Psoriasis Psoriasis is a chronic inflammatory skin disease that is driven by the dysregulation of immune cells. GM-CSF has been identified as a key cytokine in the pathogenesis of psoriasis. Mavrilimumab Biosimilar has shown efficacy in reducing the severity of psoriasis in preclinical studies. It also has the potential to improve the quality of life of psoriasis patients by reducing the itching, scaling, and pain associated with the disease.

4. Other Autoimmune Diseases Apart from the above-mentioned diseases, Mavrilimumab Biosimilar has also shown potential in the treatment of other autoimmune diseases, such as multiple sclerosis, Crohn’s disease, and ulcerative colitis. These diseases are characterized by the dysregulation of immune cells and cytokines, which can be targeted by Mavrilimumab Biosimilar.

Conclusion

Mavrilimumab Biosimilar – Anti-CSF2RA, CD116 mAb – Research Grade is a promising therapeutic option for various inflammatory and autoimmune diseases. Its specific binding to CSF2RA and inhibition of downstream signaling pathways make it a potent and safe treatment option. With ongoing clinical trials, this biosimilar has the potential to improve the lives of patients with these debilitating diseases.

SDS-PAGE for Mavrilimumab Biosimilar - Anti-CSF2RA; CD116 mAb - Research Grade

SDS-PAGE for Mavrilimumab Biosimilar - Anti-CSF2RA; CD116  mAb - Research Grade

Mavrilimumab Biosimilar - Anti-CSF2RA; CD116 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mavrilimumab Biosimilar - Anti-CSF2RA; CD116 mAb - Research Grade in ELISA Assay

Mavrilimumab Biosimilar - Anti-CSF2RA; CD116  mAb - Research Grade in ELISA Assay

Mavrilimumab Biosimilar - Anti-CSF2RA; CD116 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Mavrilimumab Biosimilar - Anti-CSF2RA, CD116  mAb - Research Grade

There are no reviews yet.

Be the first to review “Mavrilimumab Biosimilar – Anti-CSF2RA, CD116 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products