Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ipilimumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Ipilimumab ELISA Kit

Ipilimumab ELISA Kit

Product name Ipilimumab ELISA Kit
Uniprot ID P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX195
Note For research use only.
Sample type Plasma, Serum
Target Ipilimumab
Immunogen Ipilimumab

The Structure and Function of Ipilimumab ELISA Kit Introduction

Ipilimumab is a monoclonal antibody that has been approved by the FDA for the treatment of advanced melanoma, a type of skin cancer. It works by targeting a protein called CTLA-4, which is found on the surface of immune cells. This protein plays a crucial role in regulating the immune response, and by blocking it, ipilimumab helps to unleash the body’s natural ability to fight cancer.

The Structure of Ipilimumab

Ipilimumab is a fully human IgG1 monoclonal antibody, meaning that it is derived from human cells and has a structure similar to the antibodies produced by our own immune system. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains are made up of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain one constant domain (CL) and one variable domain (VL).

The variable domains are responsible for binding to the target protein, CTLA-4, while the constant domains provide stability and facilitate interactions with other immune cells and molecules. The structure of ipilimumab allows it to specifically recognize and bind to CTLA-4, which is crucial for its therapeutic activity.

The Activity of Ipilimumab

Ipilimumab works by blocking the activity of CTLA-4, a protein that is expressed on the surface of T cells, a type of immune cell. CTLA-4 acts as a checkpoint, regulating the activity of T cells and preventing them from attacking healthy cells. However, in cancer, this checkpoint can be exploited by tumor cells to evade the immune system and continue growing.

By binding to CTLA-4, ipilimumab prevents it from interacting with its natural ligands and inhibits its activity. This allows T cells to remain activated and attack cancer cells, leading to tumor regression. Additionally, ipilimumab can also activate other immune cells, such as natural killer cells and macrophages, to further enhance the anti-tumor immune response.

The Application of Ipilimumab ELISA Kit

The Ipilimumab ELISA (enzyme-linked immunosorbent assay) Kit is a laboratory test that is used to measure the levels of ipilimumab in patient samples, such as blood or serum. This test is important for monitoring the drug levels in patients receiving ipilimumab therapy, as well as for determining the appropriate dosage.

The Ipilimumab ELISA Kit works by using specific antibodies that can recognize and bind to ipilimumab in a patient sample. These antibodies are coated onto a microplate, which is then incubated with the sample. If ipilimumab is present in the sample, it will bind to the antibodies on the plate. The plate is then washed to remove any unbound material, and a secondary antibody is added that can detect the bound ipilimumab. This secondary antibody is linked to an enzyme, which produces a color change when it reacts with a substrate. The intensity of this color change is directly proportional to the amount of ipilimumab present in the sample, allowing for quantification.

In addition to measuring drug levels, the Ipilimumab ELISA Kit can also be used to detect the presence of anti-drug antibodies (ADAs) in patient samples. These ADAs can bind to ipilimumab and neutralize its activity, reducing its effectiveness in treating cancer. By measuring the levels of ADAs, the Ipilimumab ELISA Kit can help clinicians monitor the development of immune responses to the drug and adjust treatment accordingly.

Conclusion

In summary, the Ipilimumab ELISA Kit plays a crucial role in the development and monitoring of ipilimumab therapy for patients with advanced melanoma. Its ability to accurately measure drug levels and detect ADAs helps to ensure the effectiveness of this important cancer treatment. With

Ipilimumab ELISA Kit

There are no reviews yet.

Be the first to review “Ipilimumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products